Back to All Skills
Best Claude Code Skills for Go
577 skills tagged with “go”
Algorithmic Art
Creating algorithmic art using p5.js with seeded randomness and interactive parameter exploration. Use this when users request creating art using code, generative art, algorithmic art, flow fields, or particle systems. Create original algorithmic art rather than copying existing…
go
Claude Api
Reference for the Claude API / Anthropic SDK — model ids, pricing, params, streaming, tool use, MCP, agents, caching, token counting, model migration. TRIGGER — read BEFORE opening the target file; don't skip because it "looks like a one-liner" — whenever: the prompt names Claud…
goapiaillm+2
Docx
Use this skill whenever the user wants to create, read, edit, or manipulate Word documents (.docx files). Triggers include: any mention of 'Word doc', 'word document', '.docx', or requests to produce professional documents with formatting like tables of contents, headings, page …
go
Xlsx
Use this skill any time a spreadsheet file is the primary input or output. This means any task where the user wants to: open, read, edit, or fix an existing .xlsx, .xlsm, .csv, or .tsv file (e.g., adding columns, computing formulas, formatting, charting, cleaning messy data); cr…
pythongoapirest
Revenue Operations
Analyzes sales pipeline health, revenue forecasting accuracy, and go-to-market efficiency metrics for SaaS revenue optimization. Use when analyzing sales pipeline coverage, forecasting revenue, evaluating go-to-market performance, reviewing sales metrics, assessing pipeline anal…
goperformancerag
Business Operations Skills
Use when running, diagnosing, or designing internal business operations — process documentation, vendor SLAs, capacity planning, internal comms, SOP/runbook authoring, procurement spend. Triggers on "BizOps review", "where's the bottleneck", "vendor health", "internal SOP", "all…
go
Knowledge Ops
Use when a Head of Ops, Knowledge Manager, or TPM-Internal needs to author, validate, or clean up company SOPs and internal runbooks (procurement intake, vendor offboarding, incident-comms cascade, employee onboarding) — including 5W2H completeness checks (Who-What-When-Where-Wh…
pythongoai
Procurement Optimizer
Use when running an annual SaaS audit, doing category-level spend review, or rationalizing the supplier base — when the user needs a spend audit, spend categorization (UNSPSC-aligned with Pareto breakdown and industry profiles), purchasing-cycle analysis (bottleneck categories p…
goai
Chief Ai Officer Advisor
Chief AI Officer advisory for startups: model build-vs-buy decisions (API vs fine-tune vs in-house), AI risk classification under EU AI Act + US state patchwork, AI cost economics (API-to-self-hosted breakeven), and AI team org evolution. Use when deciding whether to call an API…
goapiai
Executive Mentor
Adversarial thinking partner for founders and executives. Stress-tests plans, prepares for brutal board meetings, dissects decisions with no good options, and forces honest post-mortems. Use when you need someone to find the holes before the board does, make a decision you've be…
go
Hard Call
/em:hard-call — Framework for decisions with no good options. Use when every option is painful and a structured 10/10/10 + regret-minimization pass is needed — e.g. choosing between a layoff and a down round, or killing a beloved product line.
goai
Intl Expansion
International market expansion strategy. Market selection, entry modes, localization, regulatory compliance, and go-to-market by region. Use when expanding to new countries, evaluating international markets, planning localization, or building regional teams.
go
Ma Playbook
M&A strategy for acquiring companies or being acquired. Due diligence, valuation, integration, and deal structure. Use when evaluating acquisitions, preparing for acquisition, M&A due diligence, integration planning, or deal negotiation.
go
Strategic Alignment
Cascades strategy from boardroom to individual contributor. Detects and fixes misalignment between company goals and team execution. Covers strategy articulation, cascade mapping, orphan goal detection, silo identification, communication gap analysis, and realignment protocols. …
go
Commercial Policy
Use when designing or revising a company's commercial policy — the rules of engagement governing discounts off list price, approver thresholds, exception flows, and the deal framework that Deal Desk and AEs operate under. Covers discount matrix design (ARR band x term length x p…
go
Pricing Strategist
Use when designing or revisiting product pricing — selecting a pricing model (subscription seat-based, usage-based, value-based, freemium, or hybrid), running Van Westendorp Price Sensitivity Meter analysis on WTP survey data, or designing Good/Better/Best packaging tiers. Recom…
go
Google Workspace Cli
Google Workspace administration via the gws CLI (github.com/googleworkspace/cli). Install, authenticate, and automate Gmail, Drive, Sheets, Calendar, Docs, Chat, and Tasks. Run security audits and use local recipe templates and persona bundles. Use for Google Workspace admin, gw…
gogithubsecurityautomation+1
Report
Generate test report. Use when user says "test report", "results summary", "test status", "show results", "test dashboard", or "how did tests go".
go
Code Reviewer
Code review automation for TypeScript, JavaScript, Python, Go, Swift, Kotlin, C#, .NET, Java, C, C++, Rust, Ruby, PHP, and Dart/Flutter. Analyzes PRs for complexity and risk, checks code quality for SOLID violations and code smells, generates review reports. Use when reviewing p…
pythontypescriptjavascriptrust+4
Epic Design
Build immersive, cinematic 2.5D interactive websites using scroll storytelling, parallax depth, text animations, and premium scroll effects — no WebGL required. Use this skill for any web design task: landing pages, product sites, hero sections, scroll animations, parallax, stic…
goai
Gcp Cloud Architect
Design GCP architectures for startups and enterprises. Use when asked to design Google Cloud infrastructure, deploy to GKE or Cloud Run, configure BigQuery pipelines, optimize GCP costs, or migrate to GCP. Covers Cloud Run, GKE, Cloud Functions, Cloud SQL, BigQuery, and cost opt…
gogcp
Senior Data Engineer
Data engineering skill for building scalable data pipelines, ETL/ELT systems, and data infrastructure. Expertise in Python, SQL, Spark, Airflow, dbt, Kafka, and modern data stack. Includes data modeling, pipeline orchestration, data quality, and DataOps. Use when designing data …
pythongoai
Senior Fullstack
Fullstack development toolkit with project scaffolding for Next.js, FastAPI, MERN, and Django stacks, code quality analysis with security and complexity scoring, and stack selection guidance. Use when the user asks to "scaffold a new project", "create a Next.js app", "set up Fas…
goreactdjangosecurity+1
Stripe Integration Expert
Production-grade Stripe integrations: subscriptions with trials and proration, one-time payments, usage-based billing, checkout sessions, idempotent webhook handlers, customer portal, and invoicing. Covers Next.js, Express, and Django patterns. Use when integrating Stripe for th…
godjango
Karpathy Coder
Use when writing, reviewing, or committing code to enforce Karpathy's 4 coding principles — surface assumptions before coding, keep it simple, make surgical changes, define verifiable goals. Triggers on "review my diff", "check complexity", "am I overcomplicating this", "karpath…
gollm
Prompt Governance
Use when managing prompts in production at scale: versioning prompts, running A/B tests on prompts, building prompt registries, preventing prompt regressions, or creating eval pipelines for production AI features. Triggers: 'manage prompts in production', 'prompt versioning', 'p…
goaillmrag
Observability Designer
Design production-ready observability strategies combining metrics, logs, and traces. Includes SLI/SLO design, golden-signals monitoring, alert optimization. Use when adding observability to a new service, refactoring alerting that is too noisy, or designing an SLO program befor…
gomonitoring
Performance Profiler
Systematic performance profiling for Node.js, Python, and Go applications. Identifies CPU, memory, and I/O bottlenecks, generates flamegraphs, analyzes bundle sizes, optimizes database queries, runs load tests with k6 and Artillery. Always measures before and after. Use when inv…
pythongonodeperformance
Ship Gate
Pre-production audit that scans a codebase for security, database, deployment, code quality, AI/LLM, dependency, frontend, and observability issues. Intercepts deploy commands and blocks until critical items pass. Stack-agnostic. Use for "run ship gate", "am I ready to ship", "p…
gosecuritydeploymentai+1
Slo Architect
Use when defining, reviewing, or operating SLOs/SLIs/error budgets. Triggers on "define an SLO", "what should our SLO be", "error budget", "burn rate", "SLI", "service level objective", "Google SRE workbook", "multi-window burn-rate alert", or any reliability-target question. Sh…
gokubernetes
Design System
Captures the user's brand identity once via a 10-question onboarding wizard (primary/accent HEX + heading + body Google Fonts + design style editorial/technical/minimal/playful + default output directory + syntax theme + TOC behavior + optional logo/company), validates body-text…
goai
Md Document
Converts long-form markdown (specs, RFCs, reports, plans, explainers) into a single-file, lightly-interactive HTML document with sticky TOC, scrollspy, search filter, code-copy buttons, and design-system-driven brand tokens. Triggers when the markdown-html-orchestrator classifie…
goai
Analytics Tracking
Set up, audit, and debug analytics tracking implementation — GA4, Google Tag Manager, event taxonomy, conversion tracking, and data quality. Use when building a tracking plan from scratch, auditing existing analytics for gaps or errors, debugging missing events, or setting up GT…
goai
App Store Optimization
App Store Optimization (ASO) toolkit for researching keywords, analyzing competitor rankings, generating metadata suggestions, and improving app visibility on Apple App Store and Google Play Store. Use when the user asks about ASO, app store rankings, app metadata, app titles an…
go
Brand Guidelines
When the user wants to apply, document, or enforce brand guidelines for any product or company. Also use when the user mentions 'brand guidelines,' 'brand colors,' 'typography,' 'logo usage,' 'brand voice,' 'visual identity,' 'tone of voice,' 'brand standards,' 'style guide,' 'b…
go
Launch Strategy
When the user wants to plan a product launch, feature announcement, or release strategy. Also use when the user mentions 'launch,' 'Product Hunt,' 'feature release,' 'announcement,' 'go-to-market,' 'beta launch,' 'early access,' 'waitlist,' 'product update,' 'GTM plan,' 'launch …
goai
Marketing Demand Acquisition
Creates demand generation campaigns, optimizes paid ad spend across LinkedIn, Google, and Meta, develops SEO strategies, and structures partnership programs. Use when planning demand gen strategy, growth marketing, advertising campaigns, PPC optimization, lead generation, pipeli…
goai
Marketing Ideas
When the user needs marketing ideas, inspiration, or strategies for their SaaS or software product. Also use when the user asks for 'marketing ideas,' 'growth ideas,' 'how to market,' 'marketing strategies,' 'marketing tactics,' 'ways to promote,' or 'ideas to grow.' This skill …
go
Marketing Strategy Pmm
Product marketing skill for positioning, GTM strategy, competitive intelligence, and product launches. Use when the user asks about product positioning, go-to-market planning, competitive analysis, target audience definition, ICP definition, market research, launch plans, or sal…
go
Onboarding Cro
When the user wants to optimize post-signup onboarding, user activation, first-run experience, or time-to-value. Also use when the user mentions "onboarding flow," "activation rate," "user activation," "first-run experience," "empty states," "onboarding checklist," "aha moment,"…
goai
Paid Ads
When the user wants help with paid advertising campaigns on Google Ads, Meta (Facebook/Instagram), LinkedIn, Twitter/X, or other ad platforms. Also use when the user mentions 'PPC,' 'paid media,' 'ad copy,' 'ad creative,' 'ROAS,' 'CPA,' 'ad campaign,' 'retargeting,' or 'audience…
goai
Pricing Strategy
Design, optimize, and communicate SaaS pricing — tier structure, value metrics, pricing pages, and price increase strategy. Use when building a pricing model from scratch, redesigning existing pricing, planning a price increase, or improving a pricing page. Trigger keywords: pri…
go
Prompt Engineer Toolkit
Turns marketing prompts into tested, versioned production assets: A/B prompt evaluation against structured test cases, immutable prompt version history with diffs, ready-to-use marketing prompt templates (ad copy, email campaigns, social posts, landing pages, SEO meta), and an L…
goaillm
X Twitter Growth
X/Twitter growth engine for building audience, crafting viral content, and analyzing engagement. Use when the user wants to grow on X/Twitter, write tweets or threads, analyze their X profile, research competitors on X, plan a posting strategy, or optimize engagement. Complement…
go
Code To Prd
Reverse-engineer any codebase into a complete Product Requirements Document (PRD). Analyzes routes, components, state management, API integrations, and user interactions to produce business-readable documentation detailed enough for engineers or AI agents to fully reconstruct ev…
goreactvuedjango+3
Experiment Designer
Use when planning product experiments, writing testable hypotheses, estimating sample size, prioritizing tests, or interpreting A/B outcomes with practical statistical rigor.
go
Product Manager Toolkit
Comprehensive toolkit for product managers including RICE prioritization, customer interview analysis, PRD templates, discovery frameworks, and go-to-market strategies. Use when prioritizing features, synthesizing user research, writing requirement documentation, or developing p…
go
Product Strategist
Strategic product leadership toolkit for Head of Product covering OKR cascade generation, quarterly planning, competitive landscape analysis, product vision documents, and team scaling proposals. Use when creating quarterly OKR documents, defining product goals or KPIs, building…
go
Spec To Repo
Use when the user says 'build me an app', 'create a project from this spec', 'scaffold a new repo', 'generate a starter', 'turn this idea into code', 'bootstrap a project', 'I have requirements and need a codebase', or provides a natural-language project specification and expect…
rustgoapiai
Capture
Captures and organizes chaotic brain dumps into a structured, actionable system with zero information loss. Use this skill whenever the user says 'capture this', 'brain dump', 'let me dump some ideas', 'I've got a bunch of thoughts', 'here's everything on my mind', 'idea dump', …
goai
Inbox Triage
Runs a full inbox triage using the knowledge base created by the 'inbox-setup' skill. Light-intake by design (most invocations skip questions and run with KB-default preferences); asks at most 2 grill-me override questions when invocation is outside normal cadence or includes ca…
goai
Reflect
Mid-conversation reflection skill that pauses execution and zooms out from detail-mode to honestly reassess direction, assumptions, and bias. Use when the user says 'reflect', 'take a step back', 'step back', 'zoom out', 'are we missing something', 'bigger picture', 'sanity chec…
gorestai
Atlassian Admin
Atlassian Administrator for managing and organizing Atlassian products (Jira, Confluence, Bitbucket, Trello), users, permissions, security, integrations, system configuration, and org-wide governance. Use when asked to add users to Jira, change Confluence permissions, configure …
gojirasecurity
Confluence Expert
Atlassian Confluence expert for creating and managing spaces, knowledge bases, and documentation. Configures space permissions and hierarchies, creates page templates with macros, sets up documentation taxonomies, designs page layouts, and manages content governance. Use when us…
gojirarest
Eu Ai Act Specialist
EU AI Act (Regulation (EU) 2024/1689) operational compliance for compliance teams. Three Article-level decisions: (1) What's the risk tier of this AI system — prohibited (Art. 5), high-risk (Art. 6 + Annex III), limited-risk (Art. 50), or minimal-risk? (2) For high-risk systems,…
goai
Iso42001 Specialist
ISO/IEC 42001:2023 AI Management System (AIMS) specialist for compliance teams running internal audits. Three decisions: (1) Where are the gaps against Clauses 4-10 and what do we close first? (2) What goes in the AI risk register and which Annex A controls treat each risk? (3) …
goai
Information Security Manager Iso27001
ISO 27001 ISMS implementation and cybersecurity governance for HealthTech and MedTech companies. Use when designing an ISMS, running security risk assessments, implementing controls, pursuing ISO 27001 certification, preparing security audits, responding to security incidents, o…
gosecurity
Quality Manager Qmr
Senior Quality Manager Responsible Person (QMR) for HealthTech and MedTech companies. Provides quality system governance, management review leadership, regulatory compliance oversight, and quality performance monitoring per ISO 13485 Clause 5.5.2. Use when leading management rev…
goperformancemonitoring
Clinical Research
Use when designing a prospective clinical study before submission — selecting and classifying endpoints (primary / key-secondary / exploratory, with surrogate-endpoint flagging), estimating sample size and power for two-arm designs (means / proportions / survival), or scoring a …
go
Product Research
Use when planning and synthesizing product/user research as a method-and-repository discipline — selecting the right method for the goal (generative interviews vs usability test vs concept test vs validation), computing method-based saturation/sample size with an explicit confid…
go
Dossier
Decision-grade entity research skill — produces a hypothesis-tested dossier on a specific company, person, nonprofit, or government org, not a generic profile. Forcing intake makes the user state their hypothesis upfront (what they already believe and want to verify or disprove)…
gogithubapirag
Notebooklm
Browser automation skill for controlling Google's NotebookLM. Use when the user wants anything done in NotebookLM (e.g., 'open NotebookLM', 'check my [name] notebook', 'ask my notebook about X', 'add [source] to NotebookLM', 'generate a Video Overview from my notebook', 'use Not…
gobrowserautomationai
Patent
Patent prior-art and landscape intelligence skill — not generic patent help. Commits to one of five sub-use-cases via forcing intake (novelty search / freedom-to-operate / competitive landscape / acquisition diligence / litigation prior-art) before any search runs. Searches Goog…
goairag
Syllabus
Generates a curated supplementary reading list from any course syllabus using Consensus academic search. Grill-me intake (syllabus input format + course audience + year range) plus a grouping forcing-options checkpoint before any search runs — so the reading list matches the cou…
goai
Brainstorm Okrs
Brainstorm team-level OKRs aligned with company objectives — qualitative objectives with measurable key results. Use when setting quarterly OKRs, aligning team goals with company strategy, drafting objectives, or learning how to write effective OKRs.
goai
Pre Mortem
Run a pre-mortem risk analysis on a PRD or launch plan. Categorizes risks as Tigers (real problems), Paper Tigers (overblown concerns), and Elephants (unspoken worries), then classifies as launch-blocking, fast-follow, or track. Use when preparing for launch, stress-testing a pr…
gotesting
Release Notes
Generate user-facing release notes from tickets, PRDs, or changelogs. Creates clear, engaging summaries organized by category (new features, improvements, fixes). Use when writing release notes, creating changelogs, announcing product updates, or summarizing what shipped.
go
Gtm Strategy
Create a go-to-market strategy covering marketing channels, messaging, success metrics, and launch timeline. Use when planning a product launch, creating a GTM plan from scratch, or defining a launch strategy for a new market.
go
Identify Assumptions New
Identify risky assumptions for a new product idea across 8 risk categories including Go-to-Market, Strategy, and Team. Use when evaluating startup risks, assessing a new product concept, or mapping assumptions for a new venture.
go
Api Rate Limiting
Implements API rate limiting using token bucket, sliding window, and Redis-based algorithms to protect against abuse. Use when securing public APIs, implementing tiered access, or preventing denial-of-service attacks.
goredisapiai
App Store Deployment
Publishes mobile applications to iOS App Store and Google Play with code signing, versioning, and CI/CD automation. Use when preparing app releases, configuring signing certificates, or setting up automated deployment pipelines.
godeploymentautomation
Architecture Patterns
Implement proven backend architecture patterns including Clean Architecture, Hexagonal Architecture, and Domain-Driven Design. Use when architecting complex backend systems or refactoring existing applications for better maintainability.
goai
Code Review
Code review practices with technical rigor and verification gates. Use for receiving feedback, requesting code-reviewer subagent reviews, or preventing false completion claims in pull requests.
goaiagent
Gemini Cli
Google Gemini CLI for second opinions, architectural advice, code reviews, security audits. Leverage 1M+ context for comprehensive codebase analysis via command-line tool.
gosecurityrag
Google Gemini Api
Google Gemini API with @google/genai SDK. Use for multimodal AI, thinking mode, function calling, or encountering SDK deprecation warnings, context errors, multimodal format errors.
goapiai
Google Gemini Embeddings
Google Gemini embeddings API (gemini-embedding-001) for RAG and semantic search. Use for vector search, Vectorize integration, or encountering dimension mismatches, rate limits, text truncation.
goapiembeddingrag
Google Gemini File Search
Google Gemini File Search for managed RAG with 100+ file formats. Use for document Q&A, knowledge bases, or encountering immutability errors, quota issues, polling failures. Supports Gemini 3 Pro/Flash (Gemini 2.5 legacy).
goairag
Hugo
Hugo static site generator with Tailwind v4, headless CMS (Sveltia/Tina), Cloudflare deployment. Use for blogs, docs sites, or encountering theme installation, frontmatter, baseURL errors.
gocloudflaredeploymentai
Session Management
Implements secure session management with JWT tokens, Redis storage, refresh flows, and proper cookie configuration. Use when building authentication systems, managing user sessions, or implementing secure logout functionality.
goredisrag
Sveltia Cms
Sveltia CMS Git-backed content management (Decap/Netlify CMS successor). 5x smaller bundle (300 KB), GraphQL performance, solves 260+ issues. Use for static sites (Hugo, Jekyll, 11ty, Gatsby, Astro, Next.js), blogs, docs, i18n, or encountering OAuth errors, TOML/YAML issues, COR…
goperformancegraphql
Tailwind V4 Shadcn
| Production-tested setup for Tailwind CSS v4 with shadcn/ui, Vite, and React. Use when: initializing React projects with Tailwind v4, setting up shadcn/ui, implementing dark mode, debugging CSS variable issues, fixing theme switching, migrating from Tailwind v3, or encountering…
goreactai
Receiving Code Review
Use when receiving code review feedback, before implementing suggestions, especially if feedback seems unclear or technically questionable - requires technical rigor and verification, not performative agreement or blind implementation
go
Bash Script Helper
Configure with bash script helper operations. Auto-activating skill for DevOps Basics. Triggers on: bash script helper, bash script helper Part of the DevOps Basics skill category. Use when working with bash script helper functionality. Trigger with phrases like "bash script hel…
go
Branch Naming Helper
Configure with branch naming helper operations. Auto-activating skill for DevOps Basics. Triggers on: branch naming helper, branch naming helper Part of the DevOps Basics skill category. Use when working with branch naming helper functionality. Trigger with phrases like "branch …
go
Changelog Creator
Create changelog creator operations. Auto-activating skill for DevOps Basics. Triggers on: changelog creator, changelog creator Part of the DevOps Basics skill category. Use when working with changelog creator functionality. Trigger with phrases like "changelog creator", "change…
go
Commit Message Formatter
Manage commit message formatter operations. Auto-activating skill for DevOps Basics. Triggers on: commit message formatter, commit message formatter Part of the DevOps Basics skill category. Use when working with commit message formatter functionality. Trigger with phrases like …
go
Docker Compose Creator
Create docker compose creator operations. Auto-activating skill for DevOps Basics. Triggers on: docker compose creator, docker compose creator Part of the DevOps Basics skill category. Use when working with docker compose creator functionality. Trigger with phrases like "docker …
godocker
Dockerfile Generator
Generate dockerfile generator operations. Auto-activating skill for DevOps Basics. Triggers on: dockerfile generator, dockerfile generator Part of the DevOps Basics skill category. Use when working with dockerfile generator functionality. Trigger with phrases like "dockerfile ge…
godocker
Dotenv Manager
Manage dotenv manager operations. Auto-activating skill for DevOps Basics. Triggers on: dotenv manager, dotenv manager Part of the DevOps Basics skill category. Use when working with dotenv manager functionality. Trigger with phrases like "dotenv manager", "dotenv manager", "dot…
go
Environment Variables Handler
Manage environment variables handler operations. Auto-activating skill for DevOps Basics. Triggers on: environment variables handler, environment variables handler Part of the DevOps Basics skill category. Use when working with environment variables handler functionality. Trigge…
go
Git Workflow Manager
Manage git workflow manager operations. Auto-activating skill for DevOps Basics. Triggers on: git workflow manager, git workflow manager Part of the DevOps Basics skill category. Use when working with git workflow manager functionality. Trigger with phrases like "git workflow ma…
go
Github Actions Starter
Manage github actions starter operations. Auto-activating skill for DevOps Basics. Triggers on: github actions starter, github actions starter Part of the DevOps Basics skill category. Use when working with github actions starter functionality. Trigger with phrases like "github …
gogithub
Gitignore Generator
Generate gitignore generator operations. Auto-activating skill for DevOps Basics. Triggers on: gitignore generator, gitignore generator Part of the DevOps Basics skill category. Use when working with gitignore generator functionality. Trigger with phrases like "gitignore generat…
go
Gitlab Ci Basics
Manage gitlab ci basics operations. Auto-activating skill for DevOps Basics. Triggers on: gitlab ci basics, gitlab ci basics Part of the DevOps Basics skill category. Use when working with gitlab ci basics functionality. Trigger with phrases like "gitlab ci basics", "gitlab basi…
gogitlab
Jenkins Pipeline Intro
Manage jenkins pipeline intro operations. Auto-activating skill for DevOps Basics. Triggers on: jenkins pipeline intro, jenkins pipeline intro Part of the DevOps Basics skill category. Use when working with jenkins pipeline intro functionality. Trigger with phrases like "jenkins…
go
Json Config Manager
Manage json config manager operations. Auto-activating skill for DevOps Basics. Triggers on: json config manager, json config manager Part of the DevOps Basics skill category. Use when configuring systems or services. Trigger with phrases like "json config manager", "json manage…
go
Linux Commands Guide
Manage linux commands guide operations. Auto-activating skill for DevOps Basics. Triggers on: linux commands guide, linux commands guide Part of the DevOps Basics skill category. Use when working with linux commands guide functionality. Trigger with phrases like "linux commands …
go
Makefile Generator
Generate makefile generator operations. Auto-activating skill for DevOps Basics. Triggers on: makefile generator, makefile generator Part of the DevOps Basics skill category. Use when working with makefile generator functionality. Trigger with phrases like "makefile generator", …
go
Npm Scripts Optimizer
Optimize npm scripts optimizer operations. Auto-activating skill for DevOps Basics. Triggers on: npm scripts optimizer, npm scripts optimizer Part of the DevOps Basics skill category. Use when working with npm scripts optimizer functionality. Trigger with phrases like "npm scrip…
go
Package Json Manager
Manage package json manager operations. Auto-activating skill for DevOps Basics. Triggers on: package json manager, package json manager Part of the DevOps Basics skill category. Use when working with package json manager functionality. Trigger with phrases like "package json ma…
go
Pre Commit Hook Setup
Configure pre commit hook setup operations. Auto-activating skill for DevOps Basics. Triggers on: pre commit hook setup, pre commit hook setup Part of the DevOps Basics skill category. Use when working with pre commit hook setup functionality. Trigger with phrases like "pre comm…
go
Readme Generator
Generate readme generator operations. Auto-activating skill for DevOps Basics. Triggers on: readme generator, readme generator Part of the DevOps Basics skill category. Use when working with readme generator functionality. Trigger with phrases like "readme generator", "readme ge…
go
Release Notes Generator
Generate release notes generator operations. Auto-activating skill for DevOps Basics. Triggers on: release notes generator, release notes generator Part of the DevOps Basics skill category. Use when working with release notes generator functionality. Trigger with phrases like "r…
go
Ssh Key Manager
Manage ssh key manager operations. Auto-activating skill for DevOps Basics. Triggers on: ssh key manager, ssh key manager Part of the DevOps Basics skill category. Use when working with ssh key manager functionality. Trigger with phrases like "ssh key manager", "ssh manager", "s…
go
Version Bumper
Manage version bumper operations. Auto-activating skill for DevOps Basics. Triggers on: version bumper, version bumper Part of the DevOps Basics skill category. Use when working with version bumper functionality. Trigger with phrases like "version bumper", "version bumper", "ver…
go
Yaml Config Validator
Validate yaml config validator operations. Auto-activating skill for DevOps Basics. Triggers on: yaml config validator, yaml config validator Part of the DevOps Basics skill category. Use when configuring systems or services. Trigger with phrases like "yaml config validator", "y…
go
Alertmanager Rules Config
Manage alertmanager rules config operations. Auto-activating skill for DevOps Advanced. Triggers on: alertmanager rules config, alertmanager rules config Part of the DevOps Advanced skill category. Use when configuring systems or services. Trigger with phrases like "alertmanager…
go
Ansible Playbook Generator
Generate ansible playbook generator operations. Auto-activating skill for DevOps Advanced. Triggers on: ansible playbook generator, ansible playbook generator Part of the DevOps Advanced skill category. Use when working with ansible playbook generator functionality. Trigger with…
go
Ansible Role Creator
Create ansible role creator operations. Auto-activating skill for DevOps Advanced. Triggers on: ansible role creator, ansible role creator Part of the DevOps Advanced skill category. Use when working with ansible role creator functionality. Trigger with phrases like "ansible rol…
go
Argocd App Deployer
Deploy argocd app deployer operations. Auto-activating skill for DevOps Advanced. Triggers on: argocd app deployer, argocd app deployer Part of the DevOps Advanced skill category. Use when deploying applications or services. Trigger with phrases like "argocd app deployer", "argo…
go
Cert Manager Setup
Manage cert manager setup operations. Auto-activating skill for DevOps Advanced. Triggers on: cert manager setup, cert manager setup Part of the DevOps Advanced skill category. Use when working with cert manager setup functionality. Trigger with phrases like "cert manager setup"…
go
Consul Service Discovery
Manage consul service discovery operations. Auto-activating skill for DevOps Advanced. Triggers on: consul service discovery, consul service discovery Part of the DevOps Advanced skill category. Use when working with consul service discovery functionality. Trigger with phrases l…
go
Elasticsearch Index Manager
Manage elasticsearch index manager operations. Auto-activating skill for DevOps Advanced. Triggers on: elasticsearch index manager, elasticsearch index manager Part of the DevOps Advanced skill category. Use when working with elasticsearch index manager functionality. Trigger wi…
go
Envoy Proxy Config
Configure envoy proxy config operations. Auto-activating skill for DevOps Advanced. Triggers on: envoy proxy config, envoy proxy config Part of the DevOps Advanced skill category. Use when configuring systems or services. Trigger with phrases like "envoy proxy config", "envoy co…
go
Fluentd Config Generator
Generate fluentd config generator operations. Auto-activating skill for DevOps Advanced. Triggers on: fluentd config generator, fluentd config generator Part of the DevOps Advanced skill category. Use when configuring systems or services. Trigger with phrases like "fluentd confi…
go
Flux Gitops Setup
Configure flux gitops setup operations. Auto-activating skill for DevOps Advanced. Triggers on: flux gitops setup, flux gitops setup Part of the DevOps Advanced skill category. Use when working with flux gitops setup functionality. Trigger with phrases like "flux gitops setup", …
go
Grafana Dashboard Creator
Create grafana dashboard creator operations. Auto-activating skill for DevOps Advanced. Triggers on: grafana dashboard creator, grafana dashboard creator Part of the DevOps Advanced skill category. Use when working with grafana dashboard creator functionality. Trigger with phras…
go
Helm Chart Generator
Generate helm chart generator operations. Auto-activating skill for DevOps Advanced. Triggers on: helm chart generator, helm chart generator Part of the DevOps Advanced skill category. Use when working with helm chart generator functionality. Trigger with phrases like "helm char…
go
Helm Values Manager
Manage helm values manager operations. Auto-activating skill for DevOps Advanced. Triggers on: helm values manager, helm values manager Part of the DevOps Advanced skill category. Use when working with helm values manager functionality. Trigger with phrases like "helm values man…
go
Istio Service Mesh Config
Configure istio service mesh config operations. Auto-activating skill for DevOps Advanced. Triggers on: istio service mesh config, istio service mesh config Part of the DevOps Advanced skill category. Use when configuring systems or services. Trigger with phrases like "istio ser…
go
Kubernetes Configmap Handler
Configure kubernetes configmap handler operations. Auto-activating skill for DevOps Advanced. Triggers on: kubernetes configmap handler, kubernetes configmap handler Part of the DevOps Advanced skill category. Use when configuring systems or services. Trigger with phrases like "…
gokubernetes
Kubernetes Deployment Creator
Create kubernetes deployment creator operations. Auto-activating skill for DevOps Advanced. Triggers on: kubernetes deployment creator, kubernetes deployment creator Part of the DevOps Advanced skill category. Use when deploying applications or services. Trigger with phrases lik…
gokubernetesdeployment
Kubernetes Ingress Config
Configure kubernetes ingress config operations. Auto-activating skill for DevOps Advanced. Triggers on: kubernetes ingress config, kubernetes ingress config Part of the DevOps Advanced skill category. Use when configuring systems or services. Trigger with phrases like "kubernete…
gokubernetes
Kubernetes Secrets Manager
Manage kubernetes secrets manager operations. Auto-activating skill for DevOps Advanced. Triggers on: kubernetes secrets manager, kubernetes secrets manager Part of the DevOps Advanced skill category. Use when working with kubernetes secrets manager functionality. Trigger with p…
gokubernetes
Kubernetes Service Manager
Manage kubernetes service manager operations. Auto-activating skill for DevOps Advanced. Triggers on: kubernetes service manager, kubernetes service manager Part of the DevOps Advanced skill category. Use when working with kubernetes service manager functionality. Trigger with p…
gokubernetes
Nginx Ingress Manager
Manage nginx ingress manager operations. Auto-activating skill for DevOps Advanced. Triggers on: nginx ingress manager, nginx ingress manager Part of the DevOps Advanced skill category. Use when working with nginx ingress manager functionality. Trigger with phrases like "nginx i…
go
Prometheus Config Generator
Generate prometheus config generator operations. Auto-activating skill for DevOps Advanced. Triggers on: prometheus config generator, prometheus config generator Part of the DevOps Advanced skill category. Use when configuring systems or services. Trigger with phrases like "prom…
go
Terraform Module Creator
Create terraform module creator operations. Auto-activating skill for DevOps Advanced. Triggers on: terraform module creator, terraform module creator Part of the DevOps Advanced skill category. Use when working with terraform module creator functionality. Trigger with phrases l…
go
Terraform Provider Config
Configure terraform provider config operations. Auto-activating skill for DevOps Advanced. Triggers on: terraform provider config, terraform provider config Part of the DevOps Advanced skill category. Use when configuring systems or services. Trigger with phrases like "terraform…
go
Terraform State Manager
Manage terraform state manager operations. Auto-activating skill for DevOps Advanced. Triggers on: terraform state manager, terraform state manager Part of the DevOps Advanced skill category. Use when working with terraform state manager functionality. Trigger with phrases like …
go
Vault Secrets Integrator
Configure vault secrets integrator operations. Auto-activating skill for DevOps Advanced. Triggers on: vault secrets integrator, vault secrets integrator Part of the DevOps Advanced skill category. Use when working with vault secrets integrator functionality. Trigger with phrase…
go
Api Key Manager
Manage api key manager operations. Auto-activating skill for Security Fundamentals. Triggers on: api key manager, api key manager Part of the Security Fundamentals skill category. Use when working with APIs or building integrations. Trigger with phrases like "api key manager", "…
gosecurityapi
Code Injection Detector
Detect code injection detector operations. Auto-activating skill for Security Fundamentals. Triggers on: code injection detector, code injection detector Part of the Security Fundamentals skill category. Use when working with code injection detector functionality. Trigger with p…
gosecurity
Content Security Policy Generator
Generate content security policy generator operations. Auto-activating skill for Security Fundamentals. Triggers on: content security policy generator, content security policy generator Part of the Security Fundamentals skill category. Use when working with content security poli…
gosecurity
Cookie Security Analyzer
Analyze cookie security analyzer operations. Auto-activating skill for Security Fundamentals. Triggers on: cookie security analyzer, cookie security analyzer Part of the Security Fundamentals skill category. Use when analyzing or auditing cookie security analyzer. Trigger with p…
gosecurity
Cors Policy Validator
Validate cors policy validator operations. Auto-activating skill for Security Fundamentals. Triggers on: cors policy validator, cors policy validator Part of the Security Fundamentals skill category. Use when working with cors policy validator functionality. Trigger with phrases…
gosecurity
Csrf Protection Validator
Validate csrf protection validator operations. Auto-activating skill for Security Fundamentals. Triggers on: csrf protection validator, csrf protection validator Part of the Security Fundamentals skill category. Use when working with csrf protection validator functionality. Trig…
gosecurity
Dependency Vulnerability Checker
Validate dependency vulnerability checker operations. Auto-activating skill for Security Fundamentals. Triggers on: dependency vulnerability checker, dependency vulnerability checker Part of the Security Fundamentals skill category. Use when working with dependency vulnerability…
gosecurity
Env Secret Detector
Detect env secret detector operations. Auto-activating skill for Security Fundamentals. Triggers on: env secret detector, env secret detector Part of the Security Fundamentals skill category. Use when working with env secret detector functionality. Trigger with phrases like "env…
gosecurity
Hardcoded Credential Finder
Manage hardcoded credential finder operations. Auto-activating skill for Security Fundamentals. Triggers on: hardcoded credential finder, hardcoded credential finder Part of the Security Fundamentals skill category. Use when working with hardcoded credential finder functionality…
gosecurity
Http Header Security Audit
Execute http header security audit operations. Auto-activating skill for Security Fundamentals. Triggers on: http header security audit, http header security audit Part of the Security Fundamentals skill category. Use when analyzing or auditing http header security audit. Trigge…
gosecurity
Https Certificate Checker
Validate https certificate checker operations. Auto-activating skill for Security Fundamentals. Triggers on: https certificate checker, https certificate checker Part of the Security Fundamentals skill category. Use when working with https certificate checker functionality. Trig…
gosecurity
Input Validation Checker
Validate input validation checker operations. Auto-activating skill for Security Fundamentals. Triggers on: input validation checker, input validation checker Part of the Security Fundamentals skill category. Use when working with input validation checker functionality. Trigger …
gosecurity
Insecure Deserialization Checker
Validate insecure deserialization checker operations. Auto-activating skill for Security Fundamentals. Triggers on: insecure deserialization checker, insecure deserialization checker Part of the Security Fundamentals skill category. Use when working with insecure deserialization…
gosecurity
Jwt Token Validator
Validate jwt token validator operations. Auto-activating skill for Security Fundamentals. Triggers on: jwt token validator, jwt token validator Part of the Security Fundamentals skill category. Use when working with jwt token validator functionality. Trigger with phrases like "j…
gosecurity
License Compliance Scanner
Scan license compliance scanner operations. Auto-activating skill for Security Fundamentals. Triggers on: license compliance scanner, license compliance scanner Part of the Security Fundamentals skill category. Use when working with license compliance scanner functionality. Trig…
gosecurity
Oauth2 Flow Helper
Configure with oauth2 flow helper operations. Auto-activating skill for Security Fundamentals. Triggers on: oauth2 flow helper, oauth2 flow helper Part of the Security Fundamentals skill category. Use when working with oauth2 flow helper functionality. Trigger with phrases like …
gosecurity
Password Hash Generator
Generate password hash generator operations. Auto-activating skill for Security Fundamentals. Triggers on: password hash generator, password hash generator Part of the Security Fundamentals skill category. Use when working with password hash generator functionality. Trigger with…
gosecurity
Password Strength Analyzer
Analyze password strength analyzer operations. Auto-activating skill for Security Fundamentals. Triggers on: password strength analyzer, password strength analyzer Part of the Security Fundamentals skill category. Use when analyzing or auditing password strength analyzer. Trigge…
gosecurity
Path Traversal Finder
Manage path traversal finder operations. Auto-activating skill for Security Fundamentals. Triggers on: path traversal finder, path traversal finder Part of the Security Fundamentals skill category. Use when working with path traversal finder functionality. Trigger with phrases l…
gosecurity
Rate Limiter Config
Configure rate limiter config operations. Auto-activating skill for Security Fundamentals. Triggers on: rate limiter config, rate limiter config Part of the Security Fundamentals skill category. Use when configuring systems or services. Trigger with phrases like "rate limiter co…
gosecurity
Secret Scanner
Scan secret scanner operations. Auto-activating skill for Security Fundamentals. Triggers on: secret scanner, secret scanner Part of the Security Fundamentals skill category. Use when working with secret scanner functionality. Trigger with phrases like "secret scanner", "secret …
gosecurity
Security Headers Generator
Generate security headers generator operations. Auto-activating skill for Security Fundamentals. Triggers on: security headers generator, security headers generator Part of the Security Fundamentals skill category. Use when working with security headers generator functionality. …
gosecurity
Session Security Checker
Validate session security checker operations. Auto-activating skill for Security Fundamentals. Triggers on: session security checker, session security checker Part of the Security Fundamentals skill category. Use when working with session security checker functionality. Trigger …
gosecurity
Sql Injection Detector
Detect sql injection detector operations. Auto-activating skill for Security Fundamentals. Triggers on: sql injection detector, sql injection detector Part of the Security Fundamentals skill category. Use when working with sql injection detector functionality. Trigger with phras…
gosecurity
Xss Vulnerability Scanner
Scan xss vulnerability scanner operations. Auto-activating skill for Security Fundamentals. Triggers on: xss vulnerability scanner, xss vulnerability scanner Part of the Security Fundamentals skill category. Use when working with xss vulnerability scanner functionality. Trigger …
gosecurity
Attack Surface Analyzer
Analyze attack surface analyzer operations. Auto-activating skill for Security Advanced. Triggers on: attack surface analyzer, attack surface analyzer Part of the Security Advanced skill category. Use when analyzing or auditing attack surface analyzer. Trigger with phrases like …
gosecurity
Certificate Lifecycle Manager
Manage certificate lifecycle manager operations. Auto-activating skill for Security Advanced. Triggers on: certificate lifecycle manager, certificate lifecycle manager Part of the Security Advanced skill category. Use when working with certificate lifecycle manager functionality…
gosecurity
Cloud Security Posture
Manage cloud security posture operations. Auto-activating skill for Security Advanced. Triggers on: cloud security posture, cloud security posture Part of the Security Advanced skill category. Use when working with cloud security posture functionality. Trigger with phrases like …
gosecurity
Container Security Auditor
Audit container security auditor operations. Auto-activating skill for Security Advanced. Triggers on: container security auditor, container security auditor Part of the Security Advanced skill category. Use when analyzing or auditing container security auditor. Trigger with phr…
gosecurityai
Encryption At Rest Checker
Validate encryption at rest checker operations. Auto-activating skill for Security Advanced. Triggers on: encryption at rest checker, encryption at rest checker Part of the Security Advanced skill category. Use when working with encryption at rest checker functionality. Trigger …
gosecurityrest
Forensics Data Collector
Process forensics data collector operations. Auto-activating skill for Security Advanced. Triggers on: forensics data collector, forensics data collector Part of the Security Advanced skill category. Use when working with forensics data collector functionality. Trigger with phra…
gosecurity
Gdpr Compliance Scanner
Scan gdpr compliance scanner operations. Auto-activating skill for Security Advanced. Triggers on: gdpr compliance scanner, gdpr compliance scanner Part of the Security Advanced skill category. Use when working with gdpr compliance scanner functionality. Trigger with phrases lik…
gosecurity
Hipaa Audit Helper
Assist with hipaa audit helper operations. Auto-activating skill for Security Advanced. Triggers on: hipaa audit helper, hipaa audit helper Part of the Security Advanced skill category. Use when analyzing or auditing hipaa audit helper. Trigger with phrases like "hipaa audit hel…
gosecurity
Iam Policy Reviewer
Execute iam policy reviewer operations. Auto-activating skill for Security Advanced. Triggers on: iam policy reviewer, iam policy reviewer Part of the Security Advanced skill category. Use when working with iam policy reviewer functionality. Trigger with phrases like "iam policy…
gosecurity
Incident Response Planner
Configure incident response planner operations. Auto-activating skill for Security Advanced. Triggers on: incident response planner, incident response planner Part of the Security Advanced skill category. Use when working with incident response planner functionality. Trigger wit…
gosecurity
Iso27001 Gap Analyzer
Analyze iso27001 gap analyzer operations. Auto-activating skill for Security Advanced. Triggers on: iso27001 gap analyzer, iso27001 gap analyzer Part of the Security Advanced skill category. Use when analyzing or auditing iso27001 gap analyzer. Trigger with phrases like "iso2700…
gosecurity
Key Rotation Manager
Manage key rotation manager operations. Auto-activating skill for Security Advanced. Triggers on: key rotation manager, key rotation manager Part of the Security Advanced skill category. Use when working with key rotation manager functionality. Trigger with phrases like "key rot…
gosecurity
Kubernetes Rbac Analyzer
Analyze kubernetes rbac analyzer operations. Auto-activating skill for Security Advanced. Triggers on: kubernetes rbac analyzer, kubernetes rbac analyzer Part of the Security Advanced skill category. Use when analyzing or auditing kubernetes rbac analyzer. Trigger with phrases l…
gokubernetessecurity
Log Analysis Security
Execute log analysis security operations. Auto-activating skill for Security Advanced. Triggers on: log analysis security, log analysis security Part of the Security Advanced skill category. Use when working with log analysis security functionality. Trigger with phrases like "lo…
gosecurity
Network Security Scanner
Scan network security scanner operations. Auto-activating skill for Security Advanced. Triggers on: network security scanner, network security scanner Part of the Security Advanced skill category. Use when working with network security scanner functionality. Trigger with phrases…
gosecurity
Pci Dss Validator
Validate pci dss validator operations. Auto-activating skill for Security Advanced. Triggers on: pci dss validator, pci dss validator Part of the Security Advanced skill category. Use when working with pci dss validator functionality. Trigger with phrases like "pci dss validator…
gosecurity
Penetration Test Planner
Plan penetration test planner operations. Auto-activating skill for Security Advanced. Triggers on: penetration test planner, penetration test planner Part of the Security Advanced skill category. Use when writing or running tests. Trigger with phrases like "penetration test pla…
gosecurity
Security Benchmark Runner
Manage security benchmark runner operations. Auto-activating skill for Security Advanced. Triggers on: security benchmark runner, security benchmark runner Part of the Security Advanced skill category. Use when working with security benchmark runner functionality. Trigger with p…
gosecurity
Security Policy Generator
Generate security policy generator operations. Auto-activating skill for Security Advanced. Triggers on: security policy generator, security policy generator Part of the Security Advanced skill category. Use when working with security policy generator functionality. Trigger with…
gosecurity
Siem Rule Generator
Generate siem rule generator operations. Auto-activating skill for Security Advanced. Triggers on: siem rule generator, siem rule generator Part of the Security Advanced skill category. Use when working with siem rule generator functionality. Trigger with phrases like "siem rule…
gosecurity
Soc2 Compliance Checker
Validate soc2 compliance checker operations. Auto-activating skill for Security Advanced. Triggers on: soc2 compliance checker, soc2 compliance checker Part of the Security Advanced skill category. Use when working with soc2 compliance checker functionality. Trigger with phrases…
gosecurity
Threat Model Creator
Create threat model creator operations. Auto-activating skill for Security Advanced. Triggers on: threat model creator, threat model creator Part of the Security Advanced skill category. Use when working with threat model creator functionality. Trigger with phrases like "threat …
gosecurity
Vulnerability Report Generator
Generate vulnerability report generator operations. Auto-activating skill for Security Advanced. Triggers on: vulnerability report generator, vulnerability report generator Part of the Security Advanced skill category. Use when working with vulnerability report generator functio…
gosecurity
Waf Rule Creator
Create waf rule creator operations. Auto-activating skill for Security Advanced. Triggers on: waf rule creator, waf rule creator Part of the Security Advanced skill category. Use when working with waf rule creator functionality. Trigger with phrases like "waf rule creator", "waf…
gosecurity
Zero Trust Config Helper
Configure with zero trust config helper operations. Auto-activating skill for Security Advanced. Triggers on: zero trust config helper, zero trust config helper Part of the Security Advanced skill category. Use when configuring systems or services. Trigger with phrases like "zer…
rustgosecurity
Accessibility Audit Runner
Run accessibility audit runner operations. Auto-activating skill for Frontend Development. Triggers on: accessibility audit runner, accessibility audit runner Part of the Frontend Development skill category. Use when analyzing or auditing accessibility audit runner. Trigger with…
go
Aria Attribute Helper
Configure with aria attribute helper operations. Auto-activating skill for Frontend Development. Triggers on: aria attribute helper, aria attribute helper Part of the Frontend Development skill category. Use when working with aria attribute helper functionality. Trigger with phr…
go
Bundle Size Analyzer
Analyze bundle size analyzer operations. Auto-activating skill for Frontend Development. Triggers on: bundle size analyzer, bundle size analyzer Part of the Frontend Development skill category. Use when analyzing or auditing bundle size analyzer. Trigger with phrases like "bundl…
go
Code Splitting Helper
Configure with code splitting helper operations. Auto-activating skill for Frontend Development. Triggers on: code splitting helper, code splitting helper Part of the Frontend Development skill category. Use when working with code splitting helper functionality. Trigger with phr…
go
Color Contrast Checker
Validate color contrast checker operations. Auto-activating skill for Frontend Development. Triggers on: color contrast checker, color contrast checker Part of the Frontend Development skill category. Use when working with color contrast checker functionality. Trigger with phras…
go
Css Module Generator
Generate css module generator operations. Auto-activating skill for Frontend Development. Triggers on: css module generator, css module generator Part of the Frontend Development skill category. Use when working with css module generator functionality. Trigger with phrases like …
go
Image Optimization Helper
Configure with image optimization helper operations. Auto-activating skill for Frontend Development. Triggers on: image optimization helper, image optimization helper Part of the Frontend Development skill category. Use when working with image optimization helper functionality. …
go
Keyboard Navigation Tester
Test keyboard navigation tester operations. Auto-activating skill for Frontend Development. Triggers on: keyboard navigation tester, keyboard navigation tester Part of the Frontend Development skill category. Use when writing or running tests. Trigger with phrases like "keyboard…
go
Lazy Loading Implementer
Execute lazy loading implementer operations. Auto-activating skill for Frontend Development. Triggers on: lazy loading implementer, lazy loading implementer Part of the Frontend Development skill category. Use when working with lazy loading implementer functionality. Trigger wit…
go
Open Graph Creator
Create open graph creator operations. Auto-activating skill for Frontend Development. Triggers on: open graph creator, open graph creator Part of the Frontend Development skill category. Use when working with open graph creator functionality. Trigger with phrases like "open grap…
go
Performance Lighthouse Runner
Manage performance lighthouse runner operations. Auto-activating skill for Frontend Development. Triggers on: performance lighthouse runner, performance lighthouse runner Part of the Frontend Development skill category. Use when working with performance lighthouse runner functio…
goperformance
Pinia Store Setup
Configure pinia store setup operations. Auto-activating skill for Frontend Development. Triggers on: pinia store setup, pinia store setup Part of the Frontend Development skill category. Use when working with pinia store setup functionality. Trigger with phrases like "pinia stor…
go
Pwa Manifest Generator
Generate pwa manifest generator operations. Auto-activating skill for Frontend Development. Triggers on: pwa manifest generator, pwa manifest generator Part of the Frontend Development skill category. Use when working with pwa manifest generator functionality. Trigger with phras…
go
React Component Generator
Generate react component generator operations. Auto-activating skill for Frontend Development. Triggers on: react component generator, react component generator Part of the Frontend Development skill category. Use when working with react component generator functionality. Trigge…
goreact
React Context Setup
Configure react context setup operations. Auto-activating skill for Frontend Development. Triggers on: react context setup, react context setup Part of the Frontend Development skill category. Use when working with react context setup functionality. Trigger with phrases like "re…
goreact
React Hook Creator
Create react hook creator operations. Auto-activating skill for Frontend Development. Triggers on: react hook creator, react hook creator Part of the Frontend Development skill category. Use when working with react hook creator functionality. Trigger with phrases like "react hoo…
goreact
Redux Slice Generator
Generate redux slice generator operations. Auto-activating skill for Frontend Development. Triggers on: redux slice generator, redux slice generator Part of the Frontend Development skill category. Use when working with redux slice generator functionality. Trigger with phrases l…
go
Responsive Breakpoint Analyzer
Analyze responsive breakpoint analyzer operations. Auto-activating skill for Frontend Development. Triggers on: responsive breakpoint analyzer, responsive breakpoint analyzer Part of the Frontend Development skill category. Use when analyzing or auditing responsive breakpoint an…
go
Seo Meta Generator
Generate seo meta generator operations. Auto-activating skill for Frontend Development. Triggers on: seo meta generator, seo meta generator Part of the Frontend Development skill category. Use when working with seo meta generator functionality. Trigger with phrases like "seo met…
go
Styled Components Helper
Configure with styled components helper operations. Auto-activating skill for Frontend Development. Triggers on: styled components helper, styled components helper Part of the Frontend Development skill category. Use when working with styled components helper functionality. Trig…
go
Tailwind Class Optimizer
Optimize tailwind class optimizer operations. Auto-activating skill for Frontend Development. Triggers on: tailwind class optimizer, tailwind class optimizer Part of the Frontend Development skill category. Use when working with tailwind class optimizer functionality. Trigger wi…
goai
Vue Component Generator
Generate vue component generator operations. Auto-activating skill for Frontend Development. Triggers on: vue component generator, vue component generator Part of the Frontend Development skill category. Use when working with vue component generator functionality. Trigger with p…
govue
Vue Composable Creator
Create vue composable creator operations. Auto-activating skill for Frontend Development. Triggers on: vue composable creator, vue composable creator Part of the Frontend Development skill category. Use when working with vue composable creator functionality. Trigger with phrases…
govue
Web Vitals Monitor
Monitor web vitals monitor operations. Auto-activating skill for Frontend Development. Triggers on: web vitals monitor, web vitals monitor Part of the Frontend Development skill category. Use when monitoring systems or services. Trigger with phrases like "web vitals monitor", "w…
gomonitoring
Background Worker Creator
Create background worker creator operations. Auto-activating skill for Backend Development. Triggers on: background worker creator, background worker creator Part of the Backend Development skill category. Use when working with background worker creator functionality. Trigger wi…
go
Cron Job Scheduler
Manage cron job scheduler operations. Auto-activating skill for Backend Development. Triggers on: cron job scheduler, cron job scheduler Part of the Backend Development skill category. Use when working with cron job scheduler functionality. Trigger with phrases like "cron job sc…
go
Database Schema Designer
Build database schema designer operations. Auto-activating skill for Backend Development. Triggers on: database schema designer, database schema designer Part of the Backend Development skill category. Use when working with database schema designer functionality. Trigger with ph…
go
Django View Generator
Generate django view generator operations. Auto-activating skill for Backend Development. Triggers on: django view generator, django view generator Part of the Backend Development skill category. Use when working with django view generator functionality. Trigger with phrases lik…
godjango
Error Handler Middleware
Manage error handler middleware operations. Auto-activating skill for Backend Development. Triggers on: error handler middleware, error handler middleware Part of the Backend Development skill category. Use when working with error handler middleware functionality. Trigger with p…
go
Express Route Generator
Generate express route generator operations. Auto-activating skill for Backend Development. Triggers on: express route generator, express route generator Part of the Backend Development skill category. Use when working with express route generator functionality. Trigger with phr…
go
Fastapi Router Creator
Create fastapi router creator operations. Auto-activating skill for Backend Development. Triggers on: fastapi router creator, fastapi router creator Part of the Backend Development skill category. Use when working with APIs or building integrations. Trigger with phrases like "fa…
goapi
Fastify Plugin Creator
Create fastify plugin creator operations. Auto-activating skill for Backend Development. Triggers on: fastify plugin creator, fastify plugin creator Part of the Backend Development skill category. Use when working with fastify plugin creator functionality. Trigger with phrases l…
go
Flask Blueprint Creator
Create flask blueprint creator operations. Auto-activating skill for Backend Development. Triggers on: flask blueprint creator, flask blueprint creator Part of the Backend Development skill category. Use when working with flask blueprint creator functionality. Trigger with phras…
goflask
Gin Middleware Creator
Create gin middleware creator operations. Auto-activating skill for Backend Development. Triggers on: gin middleware creator, gin middleware creator Part of the Backend Development skill category. Use when working with gin middleware creator functionality. Trigger with phrases l…
go
Go Handler Generator
Generate go handler generator operations. Auto-activating skill for Backend Development. Triggers on: go handler generator, go handler generator Part of the Backend Development skill category. Use when working with go handler generator functionality. Trigger with phrases like "g…
go
Graphql Resolver Creator
Create graphql resolver creator operations. Auto-activating skill for Backend Development. Triggers on: graphql resolver creator, graphql resolver creator Part of the Backend Development skill category. Use when working with graphql resolver creator functionality. Trigger with p…
gographql
Grpc Service Generator
Generate grpc service generator operations. Auto-activating skill for Backend Development. Triggers on: grpc service generator, grpc service generator Part of the Backend Development skill category. Use when working with grpc service generator functionality. Trigger with phrases…
go
Kafka Producer Consumer
Manage kafka producer consumer operations. Auto-activating skill for Backend Development. Triggers on: kafka producer consumer, kafka producer consumer Part of the Backend Development skill category. Use when working with kafka producer consumer functionality. Trigger with phras…
go
Memcached Config Helper
Configure with memcached config helper operations. Auto-activating skill for Backend Development. Triggers on: memcached config helper, memcached config helper Part of the Backend Development skill category. Use when configuring systems or services. Trigger with phrases like "me…
go
Nestjs Module Generator
Generate nestjs module generator operations. Auto-activating skill for Backend Development. Triggers on: nestjs module generator, nestjs module generator Part of the Backend Development skill category. Use when working with nestjs module generator functionality. Trigger with phr…
go
Prisma Schema Helper
Configure with prisma schema helper operations. Auto-activating skill for Backend Development. Triggers on: prisma schema helper, prisma schema helper Part of the Backend Development skill category. Use when working with prisma schema helper functionality. Trigger with phrases l…
go
Rabbitmq Queue Setup
Configure rabbitmq queue setup operations. Auto-activating skill for Backend Development. Triggers on: rabbitmq queue setup, rabbitmq queue setup Part of the Backend Development skill category. Use when working with rabbitmq queue setup functionality. Trigger with phrases like "…
go
Rate Limit Middleware
Manage rate limit middleware operations. Auto-activating skill for Backend Development. Triggers on: rate limit middleware, rate limit middleware Part of the Backend Development skill category. Use when working with rate limit middleware functionality. Trigger with phrases like …
go
Redis Cache Manager
Manage redis cache manager operations. Auto-activating skill for Backend Development. Triggers on: redis cache manager, redis cache manager Part of the Backend Development skill category. Use when working with redis cache manager functionality. Trigger with phrases like "redis c…
goredis
Request Validator Generator
Generate request validator generator operations. Auto-activating skill for Backend Development. Triggers on: request validator generator, request validator generator Part of the Backend Development skill category. Use when working with request validator generator functionality. …
go
Sequelize Model Creator
Create sequelize model creator operations. Auto-activating skill for Backend Development. Triggers on: sequelize model creator, sequelize model creator Part of the Backend Development skill category. Use when working with sequelize model creator functionality. Trigger with phras…
go
Sql Migration Generator
Generate sql migration generator operations. Auto-activating skill for Backend Development. Triggers on: sql migration generator, sql migration generator Part of the Backend Development skill category. Use when working with sql migration generator functionality. Trigger with phr…
go
Typeorm Entity Generator
Generate typeorm entity generator operations. Auto-activating skill for Backend Development. Triggers on: typeorm entity generator, typeorm entity generator Part of the Backend Development skill category. Use when working with typeorm entity generator functionality. Trigger with…
go
Websocket Handler Setup
Configure websocket handler setup operations. Auto-activating skill for Backend Development. Triggers on: websocket handler setup, websocket handler setup Part of the Backend Development skill category. Use when working with websocket handler setup functionality. Trigger with ph…
go
Confusion Matrix Generator
Generate confusion matrix generator operations. Auto-activating skill for ML Training. Triggers on: confusion matrix generator, confusion matrix generator Part of the ML Training skill category. Use when working with confusion matrix generator functionality. Trigger with phrases…
goai
Cross Validation Setup
Configure cross validation setup operations. Auto-activating skill for ML Training. Triggers on: cross validation setup, cross validation setup Part of the ML Training skill category. Use when working with cross validation setup functionality. Trigger with phrases like "cross va…
goai
Data Augmentation Pipeline
Process data augmentation pipeline operations. Auto-activating skill for ML Training. Triggers on: data augmentation pipeline, data augmentation pipeline Part of the ML Training skill category. Use when working with data augmentation pipeline functionality. Trigger with phrases …
goai
Dataset Loader Creator
Create dataset loader creator operations. Auto-activating skill for ML Training. Triggers on: dataset loader creator, dataset loader creator Part of the ML Training skill category. Use when working with dataset loader creator functionality. Trigger with phrases like "dataset loa…
goai
Distributed Training Setup
Configure distributed training setup operations. Auto-activating skill for ML Training. Triggers on: distributed training setup, distributed training setup Part of the ML Training skill category. Use when working with distributed training setup functionality. Trigger with phrase…
goai
Early Stopping Callback
Manage early stopping callback operations. Auto-activating skill for ML Training. Triggers on: early stopping callback, early stopping callback Part of the ML Training skill category. Use when working with early stopping callback functionality. Trigger with phrases like "early s…
goai
Feature Engineering Helper
Configure with feature engineering helper operations. Auto-activating skill for ML Training. Triggers on: feature engineering helper, feature engineering helper Part of the ML Training skill category. Use when working with feature engineering helper functionality. Trigger with p…
goai
Feature Importance Analyzer
Analyze feature importance analyzer operations. Auto-activating skill for ML Training. Triggers on: feature importance analyzer, feature importance analyzer Part of the ML Training skill category. Use when analyzing or auditing feature importance analyzer. Trigger with phrases l…
goai
Gradient Clipping Helper
Configure with gradient clipping helper operations. Auto-activating skill for ML Training. Triggers on: gradient clipping helper, gradient clipping helper Part of the ML Training skill category. Use when working with gradient clipping helper functionality. Trigger with phrases l…
goai
Hyperparameter Tuner
Manage hyperparameter tuner operations. Auto-activating skill for ML Training. Triggers on: hyperparameter tuner, hyperparameter tuner Part of the ML Training skill category. Use when working with hyperparameter tuner functionality. Trigger with phrases like "hyperparameter tune…
goai
Learning Rate Scheduler
Manage learning rate scheduler operations. Auto-activating skill for ML Training. Triggers on: learning rate scheduler, learning rate scheduler Part of the ML Training skill category. Use when working with learning rate scheduler functionality. Trigger with phrases like "learnin…
goai
Mixed Precision Trainer
Manage mixed precision trainer operations. Auto-activating skill for ML Training. Triggers on: mixed precision trainer, mixed precision trainer Part of the ML Training skill category. Use when working with mixed precision trainer functionality. Trigger with phrases like "mixed p…
goai
Mlflow Tracking Setup
Configure mlflow tracking setup operations. Auto-activating skill for ML Training. Triggers on: mlflow tracking setup, mlflow tracking setup Part of the ML Training skill category. Use when working with mlflow tracking setup functionality. Trigger with phrases like "mlflow track…
goai
Model Checkpoint Manager
Manage model checkpoint manager operations. Auto-activating skill for ML Training. Triggers on: model checkpoint manager, model checkpoint manager Part of the ML Training skill category. Use when working with model checkpoint manager functionality. Trigger with phrases like "mod…
goai
Model Evaluation Metrics
Build model evaluation metrics operations. Auto-activating skill for ML Training. Triggers on: model evaluation metrics, model evaluation metrics Part of the ML Training skill category. Use when working with model evaluation metrics functionality. Trigger with phrases like "mode…
goai
Model Explainability Tool
Build model explainability tool operations. Auto-activating skill for ML Training. Triggers on: model explainability tool, model explainability tool Part of the ML Training skill category. Use when working with model explainability tool functionality. Trigger with phrases like "…
goai
Optuna Study Creator
Create optuna study creator operations. Auto-activating skill for ML Training. Triggers on: optuna study creator, optuna study creator Part of the ML Training skill category. Use when working with optuna study creator functionality. Trigger with phrases like "optuna study creato…
goai
Pytorch Model Trainer
Build pytorch model trainer operations. Auto-activating skill for ML Training. Triggers on: pytorch model trainer, pytorch model trainer Part of the ML Training skill category. Use when working with pytorch model trainer functionality. Trigger with phrases like "pytorch model tr…
goai
Roc Curve Plotter
Manage roc curve plotter operations. Auto-activating skill for ML Training. Triggers on: roc curve plotter, roc curve plotter Part of the ML Training skill category. Use when working with roc curve plotter functionality. Trigger with phrases like "roc curve plotter", "roc plotte…
goai
Sklearn Pipeline Builder
Build sklearn pipeline builder operations. Auto-activating skill for ML Training. Triggers on: sklearn pipeline builder, sklearn pipeline builder Part of the ML Training skill category. Use when working with sklearn pipeline builder functionality. Trigger with phrases like "skle…
goai
Tensorboard Visualizer
Generate tensorboard visualizer operations. Auto-activating skill for ML Training. Triggers on: tensorboard visualizer, tensorboard visualizer Part of the ML Training skill category. Use when working with tensorboard visualizer functionality. Trigger with phrases like "tensorboa…
goai
Tensorflow Model Trainer
Build tensorflow model trainer operations. Auto-activating skill for ML Training. Triggers on: tensorflow model trainer, tensorflow model trainer Part of the ML Training skill category. Use when working with tensorflow model trainer functionality. Trigger with phrases like "tens…
goai
Train Test Splitter
Test train test splitter operations. Auto-activating skill for ML Training. Triggers on: train test splitter, train test splitter Part of the ML Training skill category. Use when writing or running tests. Trigger with phrases like "train test splitter", "train splitter", "train".
goai
Wandb Experiment Logger
Execute wandb experiment logger operations. Auto-activating skill for ML Training. Triggers on: wandb experiment logger, wandb experiment logger Part of the ML Training skill category. Use when working with wandb experiment logger functionality. Trigger with phrases like "wandb …
goai
A B Test Config Creator
Create a b test config creator operations. Auto-activating skill for ML Deployment. Triggers on: a b test config creator, a b test config creator Part of the ML Deployment skill category. Use when writing or running tests. Trigger with phrases like "a b test config creator", "a …
godeployment
Azure Ml Deployer
Deploy azure ml deployer operations. Auto-activating skill for ML Deployment. Triggers on: azure ml deployer, azure ml deployer Part of the ML Deployment skill category. Use when deploying applications or services. Trigger with phrases like "azure ml deployer", "azure deployer",…
goazuredeployment
Batch Inference Pipeline
Execute batch inference pipeline operations. Auto-activating skill for ML Deployment. Triggers on: batch inference pipeline, batch inference pipeline Part of the ML Deployment skill category. Use when working with batch inference pipeline functionality. Trigger with phrases like…
godeployment
Canary Deployment Setup
Configure canary deployment setup operations. Auto-activating skill for ML Deployment. Triggers on: canary deployment setup, canary deployment setup Part of the ML Deployment skill category. Use when deploying applications or services. Trigger with phrases like "canary deploymen…
godeployment
Fastapi Ml Endpoint
Configure fastapi ml endpoint operations. Auto-activating skill for ML Deployment. Triggers on: fastapi ml endpoint, fastapi ml endpoint Part of the ML Deployment skill category. Use when working with APIs or building integrations. Trigger with phrases like "fastapi ml endpoint"…
godeploymentapi
Feature Store Connector
Execute feature store connector operations. Auto-activating skill for ML Deployment. Triggers on: feature store connector, feature store connector Part of the ML Deployment skill category. Use when working with feature store connector functionality. Trigger with phrases like "fe…
godeployment
Flask Ml Api Creator
Create flask ml api creator operations. Auto-activating skill for ML Deployment. Triggers on: flask ml api creator, flask ml api creator Part of the ML Deployment skill category. Use when working with APIs or building integrations. Trigger with phrases like "flask ml api creator…
goflaskdeploymentapi
Gpu Resource Optimizer
Optimize gpu resource optimizer operations. Auto-activating skill for ML Deployment. Triggers on: gpu resource optimizer, gpu resource optimizer Part of the ML Deployment skill category. Use when working with gpu resource optimizer functionality. Trigger with phrases like "gpu r…
godeployment
Inference Latency Profiler
Profile inference latency profiler operations. Auto-activating skill for ML Deployment. Triggers on: inference latency profiler, inference latency profiler Part of the ML Deployment skill category. Use when working with inference latency profiler functionality. Trigger with phra…
godeployment
Model Drift Detector
Detect model drift detector operations. Auto-activating skill for ML Deployment. Triggers on: model drift detector, model drift detector Part of the ML Deployment skill category. Use when working with model drift detector functionality. Trigger with phrases like "model drift det…
godeployment
Model Export Helper
Assist with model export helper operations. Auto-activating skill for ML Deployment. Triggers on: model export helper, model export helper Part of the ML Deployment skill category. Use when working with model export helper functionality. Trigger with phrases like "model export h…
godeployment
Model Pruning Helper
Assist with model pruning helper operations. Auto-activating skill for ML Deployment. Triggers on: model pruning helper, model pruning helper Part of the ML Deployment skill category. Use when working with model pruning helper functionality. Trigger with phrases like "model prun…
godeployment
Model Quantization Tool
Build model quantization tool operations. Auto-activating skill for ML Deployment. Triggers on: model quantization tool, model quantization tool Part of the ML Deployment skill category. Use when working with model quantization tool functionality. Trigger with phrases like "mode…
godeployment
Model Registry Manager
Manage model registry manager operations. Auto-activating skill for ML Deployment. Triggers on: model registry manager, model registry manager Part of the ML Deployment skill category. Use when working with model registry manager functionality. Trigger with phrases like "model r…
godeployment
Model Versioning Manager
Manage model versioning manager operations. Auto-activating skill for ML Deployment. Triggers on: model versioning manager, model versioning manager Part of the ML Deployment skill category. Use when working with model versioning manager functionality. Trigger with phrases like …
godeployment
Onnx Converter
Convert onnx converter operations. Auto-activating skill for ML Deployment. Triggers on: onnx converter, onnx converter Part of the ML Deployment skill category. Use when working with onnx converter functionality. Trigger with phrases like "onnx converter", "onnx converter", "on…
godeployment
Prediction Monitor
Monitor prediction monitor operations. Auto-activating skill for ML Deployment. Triggers on: prediction monitor, prediction monitor Part of the ML Deployment skill category. Use when monitoring systems or services. Trigger with phrases like "prediction monitor", "prediction moni…
godeploymentmonitoring
Sagemaker Endpoint Deployer
Deploy sagemaker endpoint deployer operations. Auto-activating skill for ML Deployment. Triggers on: sagemaker endpoint deployer, sagemaker endpoint deployer Part of the ML Deployment skill category. Use when deploying applications or services. Trigger with phrases like "sagemak…
godeployment
Streaming Inference Setup
Configure streaming inference setup operations. Auto-activating skill for ML Deployment. Triggers on: streaming inference setup, streaming inference setup Part of the ML Deployment skill category. Use when working with streaming inference setup functionality. Trigger with phrase…
godeployment
Tensorflow Savedmodel Creator
Create tensorflow savedmodel creator operations. Auto-activating skill for ML Deployment. Triggers on: tensorflow savedmodel creator, tensorflow savedmodel creator Part of the ML Deployment skill category. Use when working with tensorflow savedmodel creator functionality. Trigge…
godeployment
Tensorflow Serving Setup
Configure tensorflow serving setup operations. Auto-activating skill for ML Deployment. Triggers on: tensorflow serving setup, tensorflow serving setup Part of the ML Deployment skill category. Use when working with tensorflow serving setup functionality. Trigger with phrases li…
godeployment
Torchscript Exporter
Export torchscript exporter operations. Auto-activating skill for ML Deployment. Triggers on: torchscript exporter, torchscript exporter Part of the ML Deployment skill category. Use when working with torchscript exporter functionality. Trigger with phrases like "torchscript exp…
godeployment
Torchserve Config Generator
Generate torchserve config generator operations. Auto-activating skill for ML Deployment. Triggers on: torchserve config generator, torchserve config generator Part of the ML Deployment skill category. Use when configuring systems or services. Trigger with phrases like "torchser…
godeployment
Triton Inference Config
Configure triton inference config operations. Auto-activating skill for ML Deployment. Triggers on: triton inference config, triton inference config Part of the ML Deployment skill category. Use when configuring systems or services. Trigger with phrases like "triton inference co…
godeployment
Vertex Ai Deployer
Deploy vertex ai deployer operations. Auto-activating skill for ML Deployment. Triggers on: vertex ai deployer, vertex ai deployer Part of the ML Deployment skill category. Use when deploying applications or services. Trigger with phrases like "vertex ai deployer", "vertex deplo…
godeploymentai
Api Test Generator
Generate api test generator operations. Auto-activating skill for Test Automation. Triggers on: api test generator, api test generator Part of the Test Automation skill category. Use when working with APIs or building integrations. Trigger with phrases like "api test generator",…
goautomationapi
Contract Test Creator
Create contract test creator operations. Auto-activating skill for Test Automation. Triggers on: contract test creator, contract test creator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "contract test creator", "contra…
goautomation
Coverage Report Analyzer
Analyze coverage report analyzer operations. Auto-activating skill for Test Automation. Triggers on: coverage report analyzer, coverage report analyzer Part of the Test Automation skill category. Use when analyzing or auditing coverage report analyzer. Trigger with phrases like …
goautomationrag
Database Test Helper
Assist with database test helper operations. Auto-activating skill for Test Automation. Triggers on: database test helper, database test helper Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "database test helper", "datab…
goautomation
Factory Pattern Creator
Create factory pattern creator operations. Auto-activating skill for Test Automation. Triggers on: factory pattern creator, factory pattern creator Part of the Test Automation skill category. Use when working with factory pattern creator functionality. Trigger with phrases like …
goautomation
Fixture Generator
Generate fixture generator operations. Auto-activating skill for Test Automation. Triggers on: fixture generator, fixture generator Part of the Test Automation skill category. Use when working with fixture generator functionality. Trigger with phrases like "fixture generator", "…
goautomation
Flaky Test Detector
Detect flaky test detector operations. Auto-activating skill for Test Automation. Triggers on: flaky test detector, flaky test detector Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "flaky test detector", "flaky detector…
goautomation
Go Test Generator
Generate go test generator operations. Auto-activating skill for Test Automation. Triggers on: go test generator, go test generator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "go test generator", "go generator", "go".
goautomation
Integration Test Setup
Configure integration test setup operations. Auto-activating skill for Test Automation. Triggers on: integration test setup, integration test setup Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "integration test setup", …
goautomation
Jest Test Generator
Generate jest test generator operations. Auto-activating skill for Test Automation. Triggers on: jest test generator, jest test generator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "jest test generator", "jest generat…
goautomation
Mocha Test Setup
Configure mocha test setup operations. Auto-activating skill for Test Automation. Triggers on: mocha test setup, mocha test setup Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "mocha test setup", "mocha setup", "mocha".
goautomation
Mock Generator
Generate mock generator operations. Auto-activating skill for Test Automation. Triggers on: mock generator, mock generator Part of the Test Automation skill category. Use when working with mock generator functionality. Trigger with phrases like "mock generator", "mock generator"…
goautomation
Mutation Test Runner
Run mutation test runner operations. Auto-activating skill for Test Automation. Triggers on: mutation test runner, mutation test runner Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "mutation test runner", "mutation runn…
goautomation
Property Based Test Helper
Assist with property based test helper operations. Auto-activating skill for Test Automation. Triggers on: property based test helper, property based test helper Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "property ba…
goautomation
Pytest Test Generator
Generate pytest test generator operations. Auto-activating skill for Test Automation. Triggers on: pytest test generator, pytest test generator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "pytest test generator", "pyte…
goautomation
Snapshot Test Helper
Assist with snapshot test helper operations. Auto-activating skill for Test Automation. Triggers on: snapshot test helper, snapshot test helper Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "snapshot test helper", "snaps…
goautomation
Spy Setup Helper
Assist with spy setup helper operations. Auto-activating skill for Test Automation. Triggers on: spy setup helper, spy setup helper Part of the Test Automation skill category. Use when working with spy setup helper functionality. Trigger with phrases like "spy setup helper", "sp…
goautomation
Stub Creator
Create stub creator operations. Auto-activating skill for Test Automation. Triggers on: stub creator, stub creator Part of the Test Automation skill category. Use when working with stub creator functionality. Trigger with phrases like "stub creator", "stub creator", "stub".
goautomation
Test Data Builder
Test Data Builder - Auto-activating skill for Test Automation. Triggers on: test data builder, test data builder Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test data builder", "test builder", "test".
goautomation
Test Naming Enforcer
Test Naming Enforcer - Auto-activating skill for Test Automation. Triggers on: test naming enforcer, test naming enforcer Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test naming enforcer", "test enforcer", "test".
goautomation
Test Organization Helper
Test Organization Helper - Auto-activating skill for Test Automation. Triggers on: test organization helper, test organization helper Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test organization helper", "test helper…
goautomation
Test Parallelizer
Test Parallelizer - Auto-activating skill for Test Automation. Triggers on: test parallelizer, test parallelizer Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test parallelizer", "test parallelizer", "test".
goautomation
Test Retry Config
Test Retry Config - Auto-activating skill for Test Automation. Triggers on: test retry config, test retry config Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "test retry config", "test config", "test".
goautomation
Unittest Test Creator
Create unittest test creator operations. Auto-activating skill for Test Automation. Triggers on: unittest test creator, unittest test creator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "unittest test creator", "unitte…
goautomation
Vitest Test Creator
Create vitest test creator operations. Auto-activating skill for Test Automation. Triggers on: vitest test creator, vitest test creator Part of the Test Automation skill category. Use when writing or running tests. Trigger with phrases like "vitest test creator", "vitest creator…
goautomation
Apdex Score Calculator
Calculate apdex score calculator operations. Auto-activating skill for Performance Testing. Triggers on: apdex score calculator, apdex score calculator Part of the Performance Testing skill category. Use when working with apdex score calculator functionality. Trigger with phrase…
gotestingperformance
Artillery Config Generator
Generate artillery config generator operations. Auto-activating skill for Performance Testing. Triggers on: artillery config generator, artillery config generator Part of the Performance Testing skill category. Use when configuring systems or services. Trigger with phrases like …
gotestingperformance
Benchmark Suite Creator
Create benchmark suite creator operations. Auto-activating skill for Performance Testing. Triggers on: benchmark suite creator, benchmark suite creator Part of the Performance Testing skill category. Use when working with benchmark suite creator functionality. Trigger with phras…
gotestingperformance
Bottleneck Identifier
Execute bottleneck identifier operations. Auto-activating skill for Performance Testing. Triggers on: bottleneck identifier, bottleneck identifier Part of the Performance Testing skill category. Use when working with bottleneck identifier functionality. Trigger with phrases like…
gotestingperformance
Connection Pool Analyzer
Analyze connection pool analyzer operations. Auto-activating skill for Performance Testing. Triggers on: connection pool analyzer, connection pool analyzer Part of the Performance Testing skill category. Use when analyzing or auditing connection pool analyzer. Trigger with phras…
gotestingperformance
Cpu Profiler Config
Configure cpu profiler config operations. Auto-activating skill for Performance Testing. Triggers on: cpu profiler config, cpu profiler config Part of the Performance Testing skill category. Use when configuring systems or services. Trigger with phrases like "cpu profiler config…
gotestingperformance
Database Query Profiler
Profile database query profiler operations. Auto-activating skill for Performance Testing. Triggers on: database query profiler, database query profiler Part of the Performance Testing skill category. Use when working with database query profiler functionality. Trigger with phra…
gotestingperformance
Flame Graph Generator
Generate flame graph generator operations. Auto-activating skill for Performance Testing. Triggers on: flame graph generator, flame graph generator Part of the Performance Testing skill category. Use when working with flame graph generator functionality. Trigger with phrases lik…
gotestingperformance
Gatling Scenario Creator
Create gatling scenario creator operations. Auto-activating skill for Performance Testing. Triggers on: gatling scenario creator, gatling scenario creator Part of the Performance Testing skill category. Use when working with gatling scenario creator functionality. Trigger with p…
gotestingperformance
Gc Log Analyzer
Analyze gc log analyzer operations. Auto-activating skill for Performance Testing. Triggers on: gc log analyzer, gc log analyzer Part of the Performance Testing skill category. Use when analyzing or auditing gc log analyzer. Trigger with phrases like "gc log analyzer", "gc analy…
gotestingperformance
Heap Dump Analyzer
Analyze heap dump analyzer operations. Auto-activating skill for Performance Testing. Triggers on: heap dump analyzer, heap dump analyzer Part of the Performance Testing skill category. Use when analyzing or auditing heap dump analyzer. Trigger with phrases like "heap dump analy…
gotestingperformance
Jmeter Test Plan Creator
Create jmeter test plan creator operations. Auto-activating skill for Performance Testing. Triggers on: jmeter test plan creator, jmeter test plan creator Part of the Performance Testing skill category. Use when writing or running tests. Trigger with phrases like "jmeter test pl…
gotestingperformance
K6 Script Generator
Generate k6 script generator operations. Auto-activating skill for Performance Testing. Triggers on: k6 script generator, k6 script generator Part of the Performance Testing skill category. Use when working with k6 script generator functionality. Trigger with phrases like "k6 sc…
gotestingperformance
Load Test Scenario Planner
Plan load test scenario planner operations. Auto-activating skill for Performance Testing. Triggers on: load test scenario planner, load test scenario planner Part of the Performance Testing skill category. Use when writing or running tests. Trigger with phrases like "load test …
gotestingperformance
Locust Test Creator
Create locust test creator operations. Auto-activating skill for Performance Testing. Triggers on: locust test creator, locust test creator Part of the Performance Testing skill category. Use when writing or running tests. Trigger with phrases like "locust test creator", "locust…
gotestingperformance
Memory Profiler Setup
Configure memory profiler setup operations. Auto-activating skill for Performance Testing. Triggers on: memory profiler setup, memory profiler setup Part of the Performance Testing skill category. Use when working with memory profiler setup functionality. Trigger with phrases li…
gotestingperformance
Network Latency Tester
Test network latency tester operations. Auto-activating skill for Performance Testing. Triggers on: network latency tester, network latency tester Part of the Performance Testing skill category. Use when writing or running tests. Trigger with phrases like "network latency tester…
gotestingperformance
Percentile Analyzer
Analyze percentile analyzer operations. Auto-activating skill for Performance Testing. Triggers on: percentile analyzer, percentile analyzer Part of the Performance Testing skill category. Use when analyzing or auditing percentile analyzer. Trigger with phrases like "percentile …
gotestingperformance
Performance Baseline Creator
Create performance baseline creator operations. Auto-activating skill for Performance Testing. Triggers on: performance baseline creator, performance baseline creator Part of the Performance Testing skill category. Use when working with performance baseline creator functionality…
gotestingperformance
Response Time Analyzer
Analyze response time analyzer operations. Auto-activating skill for Performance Testing. Triggers on: response time analyzer, response time analyzer Part of the Performance Testing skill category. Use when analyzing or auditing response time analyzer. Trigger with phrases like …
gotestingperformance
Soak Test Planner
Plan soak test planner operations. Auto-activating skill for Performance Testing. Triggers on: soak test planner, soak test planner Part of the Performance Testing skill category. Use when writing or running tests. Trigger with phrases like "soak test planner", "soak planner", "…
gotestingperformance
Spike Test Setup
Configure spike test setup operations. Auto-activating skill for Performance Testing. Triggers on: spike test setup, spike test setup Part of the Performance Testing skill category. Use when writing or running tests. Trigger with phrases like "spike test setup", "spike setup", "…
gotestingperformance
Stress Test Config
Configure stress test config operations. Auto-activating skill for Performance Testing. Triggers on: stress test config, stress test config Part of the Performance Testing skill category. Use when writing or running tests. Trigger with phrases like "stress test config", "stress …
gotestingperformance
Throughput Calculator
Calculate throughput calculator operations. Auto-activating skill for Performance Testing. Triggers on: throughput calculator, throughput calculator Part of the Performance Testing skill category. Use when working with throughput calculator functionality. Trigger with phrases li…
gotestingperformance
Airflow Dag Generator
Generate airflow dag generator operations. Auto-activating skill for Data Pipelines. Triggers on: airflow dag generator, airflow dag generator Part of the Data Pipelines skill category. Use when working with airflow dag generator functionality. Trigger with phrases like "airflow…
goai
Airflow Operator Creator
Create airflow operator creator operations. Auto-activating skill for Data Pipelines. Triggers on: airflow operator creator, airflow operator creator Part of the Data Pipelines skill category. Use when working with airflow operator creator functionality. Trigger with phrases lik…
goai
Beam Pipeline Builder
Build beam pipeline builder operations. Auto-activating skill for Data Pipelines. Triggers on: beam pipeline builder, beam pipeline builder Part of the Data Pipelines skill category. Use when working with beam pipeline builder functionality. Trigger with phrases like "beam pipel…
go
Cdc Pipeline Creator
Create cdc pipeline creator operations. Auto-activating skill for Data Pipelines. Triggers on: cdc pipeline creator, cdc pipeline creator Part of the Data Pipelines skill category. Use when working with cdc pipeline creator functionality. Trigger with phrases like "cdc pipeline …
go
Compression Optimizer
Optimize compression optimizer operations. Auto-activating skill for Data Pipelines. Triggers on: compression optimizer, compression optimizer Part of the Data Pipelines skill category. Use when working with compression optimizer functionality. Trigger with phrases like "compres…
go
Dagster Pipeline Creator
Create dagster pipeline creator operations. Auto-activating skill for Data Pipelines. Triggers on: dagster pipeline creator, dagster pipeline creator Part of the Data Pipelines skill category. Use when working with dagster pipeline creator functionality. Trigger with phrases lik…
go
Data Catalog Updater
Process data catalog updater operations. Auto-activating skill for Data Pipelines. Triggers on: data catalog updater, data catalog updater Part of the Data Pipelines skill category. Use when working with data catalog updater functionality. Trigger with phrases like "data catalog…
go
Data Lineage Tracker
Track data lineage tracker operations. Auto-activating skill for Data Pipelines. Triggers on: data lineage tracker, data lineage tracker Part of the Data Pipelines skill category. Use when working with data lineage tracker functionality. Trigger with phrases like "data lineage t…
go
Data Partitioner
Process data partitioner operations. Auto-activating skill for Data Pipelines. Triggers on: data partitioner, data partitioner Part of the Data Pipelines skill category. Use when working with data partitioner functionality. Trigger with phrases like "data partitioner", "data par…
go
Data Quality Checker
Validate data quality checker operations. Auto-activating skill for Data Pipelines. Triggers on: data quality checker, data quality checker Part of the Data Pipelines skill category. Use when working with data quality checker functionality. Trigger with phrases like "data qualit…
go
Dbt Model Generator
Generate dbt model generator operations. Auto-activating skill for Data Pipelines. Triggers on: dbt model generator, dbt model generator Part of the Data Pipelines skill category. Use when working with dbt model generator functionality. Trigger with phrases like "dbt model gener…
go
Dbt Test Creator
Create dbt test creator operations. Auto-activating skill for Data Pipelines. Triggers on: dbt test creator, dbt test creator Part of the Data Pipelines skill category. Use when writing or running tests. Trigger with phrases like "dbt test creator", "dbt creator", "dbt".
go
File Format Converter
Convert file format converter operations. Auto-activating skill for Data Pipelines. Triggers on: file format converter, file format converter Part of the Data Pipelines skill category. Use when working with file format converter functionality. Trigger with phrases like "file for…
go
Flink Job Creator
Create flink job creator operations. Auto-activating skill for Data Pipelines. Triggers on: flink job creator, flink job creator Part of the Data Pipelines skill category. Use when working with flink job creator functionality. Trigger with phrases like "flink job creator", "flin…
go
Incremental Load Setup
Configure incremental load setup operations. Auto-activating skill for Data Pipelines. Triggers on: incremental load setup, incremental load setup Part of the Data Pipelines skill category. Use when working with incremental load setup functionality. Trigger with phrases like "in…
go
Kafka Stream Processor
Process kafka stream processor operations. Auto-activating skill for Data Pipelines. Triggers on: kafka stream processor, kafka stream processor Part of the Data Pipelines skill category. Use when working with kafka stream processor functionality. Trigger with phrases like "kafk…
go
Luigi Task Generator
Generate luigi task generator operations. Auto-activating skill for Data Pipelines. Triggers on: luigi task generator, luigi task generator Part of the Data Pipelines skill category. Use when working with luigi task generator functionality. Trigger with phrases like "luigi task …
go
Metadata Extractor
Process metadata extractor operations. Auto-activating skill for Data Pipelines. Triggers on: metadata extractor, metadata extractor Part of the Data Pipelines skill category. Use when working with metadata extractor functionality. Trigger with phrases like "metadata extractor",…
go
Pipeline Monitoring Setup
Configure pipeline monitoring setup operations. Auto-activating skill for Data Pipelines. Triggers on: pipeline monitoring setup, pipeline monitoring setup Part of the Data Pipelines skill category. Use when monitoring systems or services. Trigger with phrases like "pipeline mon…
gomonitoring
Prefect Flow Builder
Build prefect flow builder operations. Auto-activating skill for Data Pipelines. Triggers on: prefect flow builder, prefect flow builder Part of the Data Pipelines skill category. Use when working with prefect flow builder functionality. Trigger with phrases like "prefect flow b…
go
Pyspark Transformer
Transform pyspark transformer operations. Auto-activating skill for Data Pipelines. Triggers on: pyspark transformer, pyspark transformer Part of the Data Pipelines skill category. Use when working with pyspark transformer functionality. Trigger with phrases like "pyspark transf…
go
Schema Validator
Validate schema validator operations. Auto-activating skill for Data Pipelines. Triggers on: schema validator, schema validator Part of the Data Pipelines skill category. Use when working with schema validator functionality. Trigger with phrases like "schema validator", "schema …
go
Spark Job Creator
Create spark job creator operations. Auto-activating skill for Data Pipelines. Triggers on: spark job creator, spark job creator Part of the Data Pipelines skill category. Use when working with spark job creator functionality. Trigger with phrases like "spark job creator", "spar…
go
Spark Sql Optimizer
Optimize spark sql optimizer operations. Auto-activating skill for Data Pipelines. Triggers on: spark sql optimizer, spark sql optimizer Part of the Data Pipelines skill category. Use when working with spark sql optimizer functionality. Trigger with phrases like "spark sql optim…
go
Sql Transform Helper
Assist with sql transform helper operations. Auto-activating skill for Data Pipelines. Triggers on: sql transform helper, sql transform helper Part of the Data Pipelines skill category. Use when working with sql transform helper functionality. Trigger with phrases like "sql tran…
go
Ab Test Analyzer
Analyze ab test analyzer operations. Auto-activating skill for Data Analytics. Triggers on: ab test analyzer, ab test analyzer Part of the Data Analytics skill category. Use when writing or running tests. Trigger with phrases like "ab test analyzer", "ab analyzer", "analyze ab t…
go
Aggregation Helper
Configure with aggregation helper operations. Auto-activating skill for Data Analytics. Triggers on: aggregation helper, aggregation helper Part of the Data Analytics skill category. Use when working with aggregation helper functionality. Trigger with phrases like "aggregation h…
go
Anomaly Detector
Detect anomaly detector operations. Auto-activating skill for Data Analytics. Triggers on: anomaly detector, anomaly detector Part of the Data Analytics skill category. Use when working with anomaly detector functionality. Trigger with phrases like "anomaly detector", "anomaly d…
go
Chart Type Recommender
Manage chart type recommender operations. Auto-activating skill for Data Analytics. Triggers on: chart type recommender, chart type recommender Part of the Data Analytics skill category. Use when working with chart type recommender functionality. Trigger with phrases like "chart…
go
Churn Analysis Helper
Configure with churn analysis helper operations. Auto-activating skill for Data Analytics. Triggers on: churn analysis helper, churn analysis helper Part of the Data Analytics skill category. Use when working with churn analysis helper functionality. Trigger with phrases like "c…
go
Cohort Analysis Creator
Create cohort analysis creator operations. Auto-activating skill for Data Analytics. Triggers on: cohort analysis creator, cohort analysis creator Part of the Data Analytics skill category. Use when working with cohort analysis creator functionality. Trigger with phrases like "c…
go
Complex Join Helper
Configure with complex join helper operations. Auto-activating skill for Data Analytics. Triggers on: complex join helper, complex join helper Part of the Data Analytics skill category. Use when working with complex join helper functionality. Trigger with phrases like "complex j…
go
Correlation Analyzer
Analyze correlation analyzer operations. Auto-activating skill for Data Analytics. Triggers on: correlation analyzer, correlation analyzer Part of the Data Analytics skill category. Use when analyzing or auditing correlation analyzer. Trigger with phrases like "correlation analy…
go
Cte Query Builder
Build cte query builder operations. Auto-activating skill for Data Analytics. Triggers on: cte query builder, cte query builder Part of the Data Analytics skill category. Use when working with cte query builder functionality. Trigger with phrases like "cte query builder", "cte b…
go
Dashboard Layout Planner
Configure dashboard layout planner operations. Auto-activating skill for Data Analytics. Triggers on: dashboard layout planner, dashboard layout planner Part of the Data Analytics skill category. Use when working with dashboard layout planner functionality. Trigger with phrases …
go
Data Story Outliner
Process data story outliner operations. Auto-activating skill for Data Analytics. Triggers on: data story outliner, data story outliner Part of the Data Analytics skill category. Use when working with data story outliner functionality. Trigger with phrases like "data story outli…
go
Date Range Analyzer
Analyze date range analyzer operations. Auto-activating skill for Data Analytics. Triggers on: date range analyzer, date range analyzer Part of the Data Analytics skill category. Use when analyzing or auditing date range analyzer. Trigger with phrases like "date range analyzer",…
go
Forecast Generator
Generate forecast generator operations. Auto-activating skill for Data Analytics. Triggers on: forecast generator, forecast generator Part of the Data Analytics skill category. Use when working with forecast generator functionality. Trigger with phrases like "forecast generator"…
go
Funnel Analysis Builder
Build funnel analysis builder operations. Auto-activating skill for Data Analytics. Triggers on: funnel analysis builder, funnel analysis builder Part of the Data Analytics skill category. Use when working with funnel analysis builder functionality. Trigger with phrases like "fu…
go
Kpi Definition Helper
Configure with kpi definition helper operations. Auto-activating skill for Data Analytics. Triggers on: kpi definition helper, kpi definition helper Part of the Data Analytics skill category. Use when working with kpi definition helper functionality. Trigger with phrases like "k…
go
Metric Calculator
Configure and manage - Calculate metric calculator operations. Auto-activating skill for Data Analytics. Triggers on: metric calculator, metric calculator Part of the Data Analytics skill category. Use when working with metric calculator functionality. Trigger with phrases like …
go
Pivot Table Creator
Create pivot table creator operations. Auto-activating skill for Data Analytics. Triggers on: pivot table creator, pivot table creator Part of the Data Analytics skill category. Use when working with pivot table creator functionality. Trigger with phrases like "pivot table creat…
go
Regression Analysis Helper
Configure with regression analysis helper operations. Auto-activating skill for Data Analytics. Triggers on: regression analysis helper, regression analysis helper Part of the Data Analytics skill category. Use when working with regression analysis helper functionality. Trigger …
go
Report Template Generator
Generate report template generator operations. Auto-activating skill for Data Analytics. Triggers on: report template generator, report template generator Part of the Data Analytics skill category. Use when working with report template generator functionality. Trigger with phras…
go
Retention Calculator
Configure and manage - Calculate retention calculator operations. Auto-activating skill for Data Analytics. Triggers on: retention calculator, retention calculator Part of the Data Analytics skill category. Use when working with retention calculator functionality. Trigger with p…
go
Sql Query Optimizer
Optimize sql query optimizer operations. Auto-activating skill for Data Analytics. Triggers on: sql query optimizer, sql query optimizer Part of the Data Analytics skill category. Use when working with sql query optimizer functionality. Trigger with phrases like "sql query optim…
go
Statistical Significance Calculator
Configure and manage - Calculate statistical significance calculator operations. Auto-activating skill for Data Analytics. Triggers on: statistical significance calculator, statistical significance calculator Part of the Data Analytics skill category. Use when working with stati…
go
Time Series Decomposer
Manage time series decomposer operations. Auto-activating skill for Data Analytics. Triggers on: time series decomposer, time series decomposer Part of the Data Analytics skill category. Use when working with time series decomposer functionality. Trigger with phrases like "time …
go
Visualization Best Practices
Manage visualization best practices operations. Auto-activating skill for Data Analytics. Triggers on: visualization best practices, visualization best practices Part of the Data Analytics skill category. Use when working with visualization best practices functionality. Trigger …
go
Window Function Generator
Generate window function generator operations. Auto-activating skill for Data Analytics. Triggers on: window function generator, window function generator Part of the Data Analytics skill category. Use when working with window function generator functionality. Trigger with phras…
go
Api Gateway Config
Configure api gateway config operations. Auto-activating skill for AWS Skills. Triggers on: api gateway config, api gateway config Part of the AWS Skills skill category. Use when working with APIs or building integrations. Trigger with phrases like "api gateway config", "api con…
goawsapi
Cdk Stack Generator
Generate cdk stack generator operations. Auto-activating skill for AWS Skills. Triggers on: cdk stack generator, cdk stack generator Part of the AWS Skills skill category. Use when working with cdk stack generator functionality. Trigger with phrases like "cdk stack generator", "…
goaws
Cloudformation Template Creator
Create cloudformation template creator operations. Auto-activating skill for AWS Skills. Triggers on: cloudformation template creator, cloudformation template creator Part of the AWS Skills skill category. Use when working with cloudformation template creator functionality. Trig…
goaws
Cloudfront Distribution Setup
Configure cloudfront distribution setup operations. Auto-activating skill for AWS Skills. Triggers on: cloudfront distribution setup, cloudfront distribution setup Part of the AWS Skills skill category. Use when working with cloudfront distribution setup functionality. Trigger w…
goaws
Cloudwatch Alarm Creator
Create cloudwatch alarm creator operations. Auto-activating skill for AWS Skills. Triggers on: cloudwatch alarm creator, cloudwatch alarm creator Part of the AWS Skills skill category. Use when working with cloudwatch alarm creator functionality. Trigger with phrases like "cloud…
goaws
Cost Optimization Analyzer
Analyze cost optimization analyzer operations. Auto-activating skill for AWS Skills. Triggers on: cost optimization analyzer, cost optimization analyzer Part of the AWS Skills skill category. Use when analyzing or auditing cost optimization analyzer. Trigger with phrases like "c…
goaws
Dynamodb Table Designer
Build dynamodb table designer operations. Auto-activating skill for AWS Skills. Triggers on: dynamodb table designer, dynamodb table designer Part of the AWS Skills skill category. Use when working with dynamodb table designer functionality. Trigger with phrases like "dynamodb t…
goaws
Ecs Task Definition Creator
Create ecs task definition creator operations. Auto-activating skill for AWS Skills. Triggers on: ecs task definition creator, ecs task definition creator Part of the AWS Skills skill category. Use when working with ecs task definition creator functionality. Trigger with phrases…
goaws
Eks Cluster Config
Configure eks cluster config operations. Auto-activating skill for AWS Skills. Triggers on: eks cluster config, eks cluster config Part of the AWS Skills skill category. Use when configuring systems or services. Trigger with phrases like "eks cluster config", "eks config", "eks".
goaws
Elasticache Config
Configure elasticache config operations. Auto-activating skill for AWS Skills. Triggers on: elasticache config, elasticache config Part of the AWS Skills skill category. Use when configuring systems or services. Trigger with phrases like "elasticache config", "elasticache config…
goaws
Eventbridge Rule Creator
Create eventbridge rule creator operations. Auto-activating skill for AWS Skills. Triggers on: eventbridge rule creator, eventbridge rule creator Part of the AWS Skills skill category. Use when working with eventbridge rule creator functionality. Trigger with phrases like "event…
goaws
Iam Policy Creator
Create iam policy creator operations. Auto-activating skill for AWS Skills. Triggers on: iam policy creator, iam policy creator Part of the AWS Skills skill category. Use when working with iam policy creator functionality. Trigger with phrases like "iam policy creator", "iam cre…
goaws
Iam Role Generator
Generate iam role generator operations. Auto-activating skill for AWS Skills. Triggers on: iam role generator, iam role generator Part of the AWS Skills skill category. Use when working with iam role generator functionality. Trigger with phrases like "iam role generator", "iam g…
goaws
Lambda Function Generator
Generate lambda function generator operations. Auto-activating skill for AWS Skills. Triggers on: lambda function generator, lambda function generator Part of the AWS Skills skill category. Use when working with lambda function generator functionality. Trigger with phrases like …
goaws
Lambda Layer Creator
Create lambda layer creator operations. Auto-activating skill for AWS Skills. Triggers on: lambda layer creator, lambda layer creator Part of the AWS Skills skill category. Use when working with lambda layer creator functionality. Trigger with phrases like "lambda layer creator"…
goaws
Rds Instance Setup
Configure rds instance setup operations. Auto-activating skill for AWS Skills. Triggers on: rds instance setup, rds instance setup Part of the AWS Skills skill category. Use when working with rds instance setup functionality. Trigger with phrases like "rds instance setup", "rds …
goaws
Route53 Record Manager
Manage route53 record manager operations. Auto-activating skill for AWS Skills. Triggers on: route53 record manager, route53 record manager Part of the AWS Skills skill category. Use when working with route53 record manager functionality. Trigger with phrases like "route53 recor…
goaws
S3 Bucket Policy Generator
Generate s3 bucket policy generator operations. Auto-activating skill for AWS Skills. Triggers on: s3 bucket policy generator, s3 bucket policy generator Part of the AWS Skills skill category. Use when working with s3 bucket policy generator functionality. Trigger with phrases l…
goaws
S3 Lifecycle Config
Configure s3 lifecycle config operations. Auto-activating skill for AWS Skills. Triggers on: s3 lifecycle config, s3 lifecycle config Part of the AWS Skills skill category. Use when configuring systems or services. Trigger with phrases like "s3 lifecycle config", "s3 config", "s…
goaws
Sam Template Builder
Build sam template builder operations. Auto-activating skill for AWS Skills. Triggers on: sam template builder, sam template builder Part of the AWS Skills skill category. Use when working with sam template builder functionality. Trigger with phrases like "sam template builder",…
goaws
Security Group Generator
Generate security group generator operations. Auto-activating skill for AWS Skills. Triggers on: security group generator, security group generator Part of the AWS Skills skill category. Use when working with security group generator functionality. Trigger with phrases like "sec…
goawssecurity
Sns Topic Config
Configure sns topic config operations. Auto-activating skill for AWS Skills. Triggers on: sns topic config, sns topic config Part of the AWS Skills skill category. Use when configuring systems or services. Trigger with phrases like "sns topic config", "sns config", "sns".
goaws
Sqs Queue Setup
Configure sqs queue setup operations. Auto-activating skill for AWS Skills. Triggers on: sqs queue setup, sqs queue setup Part of the AWS Skills skill category. Use when working with sqs queue setup functionality. Trigger with phrases like "sqs queue setup", "sqs setup", "sqs".
goaws
Step Functions Workflow
Manage step functions workflow operations. Auto-activating skill for AWS Skills. Triggers on: step functions workflow, step functions workflow Part of the AWS Skills skill category. Use when working with step functions workflow functionality. Trigger with phrases like "step func…
goaws
Vpc Network Designer
Build vpc network designer operations. Auto-activating skill for AWS Skills. Triggers on: vpc network designer, vpc network designer Part of the AWS Skills skill category. Use when working with vpc network designer functionality. Trigger with phrases like "vpc network designer",…
goaws
Bigquery Ml Model Creator
Create bigquery ml model creator operations. Auto-activating skill for GCP Skills. Triggers on: bigquery ml model creator, bigquery ml model creator Part of the GCP Skills skill category. Use when working with bigquery ml model creator functionality. Trigger with phrases like "b…
gogcp
Bigquery Scheduled Query
Manage bigquery scheduled query operations. Auto-activating skill for GCP Skills. Triggers on: bigquery scheduled query, bigquery scheduled query Part of the GCP Skills skill category. Use when working with bigquery scheduled query functionality. Trigger with phrases like "bigqu…
gogcp
Bigquery Table Creator
Create bigquery table creator operations. Auto-activating skill for GCP Skills. Triggers on: bigquery table creator, bigquery table creator Part of the GCP Skills skill category. Use when working with bigquery table creator functionality. Trigger with phrases like "bigquery tabl…
gogcp
Bigquery View Generator
Generate bigquery view generator operations. Auto-activating skill for GCP Skills. Triggers on: bigquery view generator, bigquery view generator Part of the GCP Skills skill category. Use when working with bigquery view generator functionality. Trigger with phrases like "bigquer…
gogcp
Cloud Function Generator
Generate cloud function generator operations. Auto-activating skill for GCP Skills. Triggers on: cloud function generator, cloud function generator Part of the GCP Skills skill category. Use when working with cloud function generator functionality. Trigger with phrases like "clo…
gogcp
Cloud Logging Sink Setup
Configure cloud logging sink setup operations. Auto-activating skill for GCP Skills. Triggers on: cloud logging sink setup, cloud logging sink setup Part of the GCP Skills skill category. Use when working with cloud logging sink setup functionality. Trigger with phrases like "cl…
gogcp
Cloud Monitoring Alert
Monitor cloud monitoring alert operations. Auto-activating skill for GCP Skills. Triggers on: cloud monitoring alert, cloud monitoring alert Part of the GCP Skills skill category. Use when monitoring systems or services. Trigger with phrases like "cloud monitoring alert", "cloud…
gogcpmonitoring
Cloud Run Service Config
Configure cloud run service config operations. Auto-activating skill for GCP Skills. Triggers on: cloud run service config, cloud run service config Part of the GCP Skills skill category. Use when configuring systems or services. Trigger with phrases like "cloud run service conf…
gogcp
Cloud Scheduler Job Creator
Create cloud scheduler job creator operations. Auto-activating skill for GCP Skills. Triggers on: cloud scheduler job creator, cloud scheduler job creator Part of the GCP Skills skill category. Use when working with cloud scheduler job creator functionality. Trigger with phrases…
gogcp
Cloud Sql Instance Setup
Configure cloud sql instance setup operations. Auto-activating skill for GCP Skills. Triggers on: cloud sql instance setup, cloud sql instance setup Part of the GCP Skills skill category. Use when working with cloud sql instance setup functionality. Trigger with phrases like "cl…
gogcp
Cloud Tasks Queue Setup
Configure cloud tasks queue setup operations. Auto-activating skill for GCP Skills. Triggers on: cloud tasks queue setup, cloud tasks queue setup Part of the GCP Skills skill category. Use when working with cloud tasks queue setup functionality. Trigger with phrases like "cloud …
gogcp
Firebase Rules Generator
Generate firebase rules generator operations. Auto-activating skill for GCP Skills. Triggers on: firebase rules generator, firebase rules generator Part of the GCP Skills skill category. Use when working with firebase rules generator functionality. Trigger with phrases like "fir…
gogcp
Firestore Index Creator
Create firestore index creator operations. Auto-activating skill for GCP Skills. Triggers on: firestore index creator, firestore index creator Part of the GCP Skills skill category. Use when working with firestore index creator functionality. Trigger with phrases like "firestore…
gogcprest
Firewall Rule Generator
Generate firewall rule generator operations. Auto-activating skill for GCP Skills. Triggers on: firewall rule generator, firewall rule generator Part of the GCP Skills skill category. Use when working with firewall rule generator functionality. Trigger with phrases like "firewal…
gogcp
Gcs Bucket Config
Configure gcs bucket config operations. Auto-activating skill for GCP Skills. Triggers on: gcs bucket config, gcs bucket config Part of the GCP Skills skill category. Use when configuring systems or services. Trigger with phrases like "gcs bucket config", "gcs config", "gcs".
gogcp
Gcs Lifecycle Policy
Manage gcs lifecycle policy operations. Auto-activating skill for GCP Skills. Triggers on: gcs lifecycle policy, gcs lifecycle policy Part of the GCP Skills skill category. Use when working with gcs lifecycle policy functionality. Trigger with phrases like "gcs lifecycle policy"…
gogcp
Gke Cluster Config
Configure gke cluster config operations. Auto-activating skill for GCP Skills. Triggers on: gke cluster config, gke cluster config Part of the GCP Skills skill category. Use when configuring systems or services. Trigger with phrases like "gke cluster config", "gke config", "gke".
gogcp
Iam Binding Creator
Create iam binding creator operations. Auto-activating skill for GCP Skills. Triggers on: iam binding creator, iam binding creator Part of the GCP Skills skill category. Use when working with iam binding creator functionality. Trigger with phrases like "iam binding creator", "ia…
gogcp
Memorystore Config
Configure memorystore config operations. Auto-activating skill for GCP Skills. Triggers on: memorystore config, memorystore config Part of the GCP Skills skill category. Use when configuring systems or services. Trigger with phrases like "memorystore config", "memorystore config…
gogcp
Pubsub Subscription Config
Configure pubsub subscription config operations. Auto-activating skill for GCP Skills. Triggers on: pubsub subscription config, pubsub subscription config Part of the GCP Skills skill category. Use when configuring systems or services. Trigger with phrases like "pubsub subscript…
gogcp
Pubsub Topic Setup
Configure pubsub topic setup operations. Auto-activating skill for GCP Skills. Triggers on: pubsub topic setup, pubsub topic setup Part of the GCP Skills skill category. Use when working with pubsub topic setup functionality. Trigger with phrases like "pubsub topic setup", "pubs…
gogcp
Service Account Manager
Manage service account manager operations. Auto-activating skill for GCP Skills. Triggers on: service account manager, service account manager Part of the GCP Skills skill category. Use when working with service account manager functionality. Trigger with phrases like "service a…
gogcp
Vertex Ai Endpoint Config
Configure vertex ai endpoint config operations. Auto-activating skill for GCP Skills. Triggers on: vertex ai endpoint config, vertex ai endpoint config Part of the GCP Skills skill category. Use when configuring systems or services. Trigger with phrases like "vertex ai endpoint …
gogcpai
Vertex Ai Pipeline Creator
Create vertex ai pipeline creator operations. Auto-activating skill for GCP Skills. Triggers on: vertex ai pipeline creator, vertex ai pipeline creator Part of the GCP Skills skill category. Use when working with vertex ai pipeline creator functionality. Trigger with phrases lik…
gogcpai
Vpc Network Setup
Configure vpc network setup operations. Auto-activating skill for GCP Skills. Triggers on: vpc network setup, vpc network setup Part of the GCP Skills skill category. Use when working with vpc network setup functionality. Trigger with phrases like "vpc network setup", "vpc setup…
gogcp
Api Caching Strategy
Configure api caching strategy operations. Auto-activating skill for API Development. Triggers on: api caching strategy, api caching strategy Part of the API Development skill category. Use when working with APIs or building integrations. Trigger with phrases like "api caching s…
goapi
Api Key Auth Setup
Configure api key auth setup operations. Auto-activating skill for API Development. Triggers on: api key auth setup, api key auth setup Part of the API Development skill category. Use when working with APIs or building integrations. Trigger with phrases like "api key auth setup"…
goapi
Api Mock Generator
Generate api mock generator operations. Auto-activating skill for API Development. Triggers on: api mock generator, api mock generator Part of the API Development skill category. Use when working with APIs or building integrations. Trigger with phrases like "api mock generator",…
goapi
Api Rate Limiting Config
Configure api rate limiting config operations. Auto-activating skill for API Development. Triggers on: api rate limiting config, api rate limiting config Part of the API Development skill category. Use when working with APIs or building integrations. Trigger with phrases like "a…
goapi
Api Testing Helper
Assist with api testing helper operations. Auto-activating skill for API Development. Triggers on: api testing helper, api testing helper Part of the API Development skill category. Use when working with APIs or building integrations. Trigger with phrases like "api testing helpe…
gotestingapi
Api Throttling Setup
Configure api throttling setup operations. Auto-activating skill for API Development. Triggers on: api throttling setup, api throttling setup Part of the API Development skill category. Use when working with APIs or building integrations. Trigger with phrases like "api throttlin…
goapi
Bearer Token Validator
Validate bearer token validator operations. Auto-activating skill for API Development. Triggers on: bearer token validator, bearer token validator Part of the API Development skill category. Use when working with bearer token validator functionality. Trigger with phrases like "b…
goapi
Conditional Request Helper
Configure with conditional request helper operations. Auto-activating skill for API Development. Triggers on: conditional request helper, conditional request helper Part of the API Development skill category. Use when working with conditional request helper functionality. Trigge…
goapi
Etag Handler
Manage etag handler operations. Auto-activating skill for API Development. Triggers on: etag handler, etag handler Part of the API Development skill category. Use when working with etag handler functionality. Trigger with phrases like "etag handler", "etag handler", "etag".
goapi
Filtering Query Builder
Build filtering query builder operations. Auto-activating skill for API Development. Triggers on: filtering query builder, filtering query builder Part of the API Development skill category. Use when working with filtering query builder functionality. Trigger with phrases like "…
goapi
Graphql Mutation Builder
Build graphql mutation builder operations. Auto-activating skill for API Development. Triggers on: graphql mutation builder, graphql mutation builder Part of the API Development skill category. Use when working with graphql mutation builder functionality. Trigger with phrases li…
goapigraphql
Graphql Schema Generator
Generate graphql schema generator operations. Auto-activating skill for API Development. Triggers on: graphql schema generator, graphql schema generator Part of the API Development skill category. Use when working with graphql schema generator functionality. Trigger with phrases…
goapigraphql
Graphql Subscription Setup
Configure graphql subscription setup operations. Auto-activating skill for API Development. Triggers on: graphql subscription setup, graphql subscription setup Part of the API Development skill category. Use when working with graphql subscription setup functionality. Trigger wit…
goapigraphql
Http Method Helper
Configure with http method helper operations. Auto-activating skill for API Development. Triggers on: http method helper, http method helper Part of the API Development skill category. Use when working with http method helper functionality. Trigger with phrases like "http method…
goapi
Hypermedia Link Generator
Generate hypermedia link generator operations. Auto-activating skill for API Development. Triggers on: hypermedia link generator, hypermedia link generator Part of the API Development skill category. Use when working with hypermedia link generator functionality. Trigger with phr…
goapi
Openapi Spec Generator
Generate openapi spec generator operations. Auto-activating skill for API Development. Triggers on: openapi spec generator, openapi spec generator Part of the API Development skill category. Use when working with APIs or building integrations. Trigger with phrases like "openapi …
goapi
Pagination Helper
Configure with pagination helper operations. Auto-activating skill for API Development. Triggers on: pagination helper, pagination helper Part of the API Development skill category. Use when working with pagination helper functionality. Trigger with phrases like "pagination help…
goapi
Request Body Validator
Validate request body validator operations. Auto-activating skill for API Development. Triggers on: request body validator, request body validator Part of the API Development skill category. Use when working with request body validator functionality. Trigger with phrases like "r…
goapi
Response Schema Generator
Generate response schema generator operations. Auto-activating skill for API Development. Triggers on: response schema generator, response schema generator Part of the API Development skill category. Use when working with response schema generator functionality. Trigger with phr…
goapi
Rest Endpoint Designer
Build rest endpoint designer operations. Auto-activating skill for API Development. Triggers on: rest endpoint designer, rest endpoint designer Part of the API Development skill category. Use when working with rest endpoint designer functionality. Trigger with phrases like "rest…
goapirest
Sorting Parameter Handler
Manage sorting parameter handler operations. Auto-activating skill for API Development. Triggers on: sorting parameter handler, sorting parameter handler Part of the API Development skill category. Use when working with sorting parameter handler functionality. Trigger with phras…
goapi
Status Code Recommender
Manage status code recommender operations. Auto-activating skill for API Development. Triggers on: status code recommender, status code recommender Part of the API Development skill category. Use when working with status code recommender functionality. Trigger with phrases like …
goapi
Swagger Doc Creator
Create swagger doc creator operations. Auto-activating skill for API Development. Triggers on: swagger doc creator, swagger doc creator Part of the API Development skill category. Use when working with swagger doc creator functionality. Trigger with phrases like "swagger doc cre…
goapi
Versioning Strategy Helper
Configure with versioning strategy helper operations. Auto-activating skill for API Development. Triggers on: versioning strategy helper, versioning strategy helper Part of the API Development skill category. Use when working with versioning strategy helper functionality. Trigge…
goapi
Api Client Generator
Generate api client generator operations. Auto-activating skill for API Integration. Triggers on: api client generator, api client generator Part of the API Integration skill category. Use when working with APIs or building integrations. Trigger with phrases like "api client gen…
goapi
Api Health Checker
Check api health checker operations. Auto-activating skill for API Integration. Triggers on: api health checker, api health checker Part of the API Integration skill category. Use when working with APIs or building integrations. Trigger with phrases like "api health checker", "a…
goapi
Api Response Cacher
Configure api response cacher operations. Auto-activating skill for API Integration. Triggers on: api response cacher, api response cacher Part of the API Integration skill category. Use when working with APIs or building integrations. Trigger with phrases like "api response cac…
goapi
Async Api Caller
Configure async api caller operations. Auto-activating skill for API Integration. Triggers on: async api caller, async api caller Part of the API Integration skill category. Use when working with APIs or building integrations. Trigger with phrases like "async api caller", "async…
goapi
Batch Request Handler
Manage batch request handler operations. Auto-activating skill for API Integration. Triggers on: batch request handler, batch request handler Part of the API Integration skill category. Use when working with batch request handler functionality. Trigger with phrases like "batch r…
goapi
Circuit Breaker Setup
Configure circuit breaker setup operations. Auto-activating skill for API Integration. Triggers on: circuit breaker setup, circuit breaker setup Part of the API Integration skill category. Use when working with circuit breaker setup functionality. Trigger with phrases like "circ…
goapi
Connection Pooling Config
Configure connection pooling config operations. Auto-activating skill for API Integration. Triggers on: connection pooling config, connection pooling config Part of the API Integration skill category. Use when configuring systems or services. Trigger with phrases like "connectio…
goapi
Error Mapping Helper
Configure with error mapping helper operations. Auto-activating skill for API Integration. Triggers on: error mapping helper, error mapping helper Part of the API Integration skill category. Use when working with error mapping helper functionality. Trigger with phrases like "err…
goapi
Http Client Config
Configure http client config operations. Auto-activating skill for API Integration. Triggers on: http client config, http client config Part of the API Integration skill category. Use when configuring systems or services. Trigger with phrases like "http client config", "http con…
goapi
Integration Test Generator
Generate integration test generator operations. Auto-activating skill for API Integration. Triggers on: integration test generator, integration test generator Part of the API Integration skill category. Use when writing or running tests. Trigger with phrases like "integration te…
goapi
Long Polling Handler
Manage long polling handler operations. Auto-activating skill for API Integration. Triggers on: long polling handler, long polling handler Part of the API Integration skill category. Use when working with long polling handler functionality. Trigger with phrases like "long pollin…
goapi
Oauth Callback Handler
Manage oauth callback handler operations. Auto-activating skill for API Integration. Triggers on: oauth callback handler, oauth callback handler Part of the API Integration skill category. Use when working with oauth callback handler functionality. Trigger with phrases like "oau…
goapi
Oauth Client Setup
Configure oauth client setup operations. Auto-activating skill for API Integration. Triggers on: oauth client setup, oauth client setup Part of the API Integration skill category. Use when working with oauth client setup functionality. Trigger with phrases like "oauth client set…
goapi
Polling Mechanism Setup
Configure polling mechanism setup operations. Auto-activating skill for API Integration. Triggers on: polling mechanism setup, polling mechanism setup Part of the API Integration skill category. Use when working with polling mechanism setup functionality. Trigger with phrases li…
goapi
Request Interceptor Creator
Create request interceptor creator operations. Auto-activating skill for API Integration. Triggers on: request interceptor creator, request interceptor creator Part of the API Integration skill category. Use when working with request interceptor creator functionality. Trigger wi…
goapi
Response Transformer
Transform response transformer operations. Auto-activating skill for API Integration. Triggers on: response transformer, response transformer Part of the API Integration skill category. Use when working with response transformer functionality. Trigger with phrases like "response…
goapi
Retry Logic Helper
Assist with retry logic helper operations. Auto-activating skill for API Integration. Triggers on: retry logic helper, retry logic helper Part of the API Integration skill category. Use when working with retry logic helper functionality. Trigger with phrases like "retry logic he…
goapi
Sdk Wrapper Creator
Create sdk wrapper creator operations. Auto-activating skill for API Integration. Triggers on: sdk wrapper creator, sdk wrapper creator Part of the API Integration skill category. Use when working with sdk wrapper creator functionality. Trigger with phrases like "sdk wrapper cre…
goapi
Server Sent Events Setup
Configure server sent events setup operations. Auto-activating skill for API Integration. Triggers on: server sent events setup, server sent events setup Part of the API Integration skill category. Use when working with server sent events setup functionality. Trigger with phrase…
goapi
Timeout Handler
Manage timeout handler operations. Auto-activating skill for API Integration. Triggers on: timeout handler, timeout handler Part of the API Integration skill category. Use when working with timeout handler functionality. Trigger with phrases like "timeout handler", "timeout hand…
goapi
Webhook Receiver Generator
Generate webhook receiver generator operations. Auto-activating skill for API Integration. Triggers on: webhook receiver generator, webhook receiver generator Part of the API Integration skill category. Use when working with webhook receiver generator functionality. Trigger with…
goapi
Webhook Retry Handler
Manage webhook retry handler operations. Auto-activating skill for API Integration. Triggers on: webhook retry handler, webhook retry handler Part of the API Integration skill category. Use when working with webhook retry handler functionality. Trigger with phrases like "webhook…
goapi
Webhook Sender Creator
Create webhook sender creator operations. Auto-activating skill for API Integration. Triggers on: webhook sender creator, webhook sender creator Part of the API Integration skill category. Use when working with webhook sender creator functionality. Trigger with phrases like "web…
goapi
Webhook Signature Validator
Validate webhook signature validator operations. Auto-activating skill for API Integration. Triggers on: webhook signature validator, webhook signature validator Part of the API Integration skill category. Use when working with webhook signature validator functionality. Trigger …
goapi
Websocket Client Creator
Create websocket client creator operations. Auto-activating skill for API Integration. Triggers on: websocket client creator, websocket client creator Part of the API Integration skill category. Use when working with websocket client creator functionality. Trigger with phrases l…
goapi
Adr Generator
Generate adr generator operations. Auto-activating skill for Technical Documentation. Triggers on: adr generator, adr generator Part of the Technical Documentation skill category. Use when working with adr generator functionality. Trigger with phrases like "adr generator", "adr …
go
Api Reference Creator
Create api reference creator operations. Auto-activating skill for Technical Documentation. Triggers on: api reference creator, api reference creator Part of the Technical Documentation skill category. Use when working with APIs or building integrations. Trigger with phrases lik…
goapi
Architecture Doc Creator
Create architecture doc creator operations. Auto-activating skill for Technical Documentation. Triggers on: architecture doc creator, architecture doc creator Part of the Technical Documentation skill category. Use when working with architecture doc creator functionality. Trigge…
go
Changelog Generator
Generate changelog generator operations. Auto-activating skill for Technical Documentation. Triggers on: changelog generator, changelog generator Part of the Technical Documentation skill category. Use when working with changelog generator functionality. Trigger with phrases lik…
go
Code Documentation Analyzer
Analyze code documentation analyzer operations. Auto-activating skill for Technical Documentation. Triggers on: code documentation analyzer, code documentation analyzer Part of the Technical Documentation skill category. Use when analyzing or auditing code documentation analyzer…
go
Code Of Conduct Generator
Generate code of conduct generator operations. Auto-activating skill for Technical Documentation. Triggers on: code of conduct generator, code of conduct generator Part of the Technical Documentation skill category. Use when working with code of conduct generator functionality. …
go
Configuration Reference Generator
Generate configuration reference generator operations. Auto-activating skill for Technical Documentation. Triggers on: configuration reference generator, configuration reference generator Part of the Technical Documentation skill category. Use when configuring systems or service…
go
Contributing Guide Creator
Create contributing guide creator operations. Auto-activating skill for Technical Documentation. Triggers on: contributing guide creator, contributing guide creator Part of the Technical Documentation skill category. Use when working with contributing guide creator functionality…
go
Deprecation Notice Generator
Generate deprecation notice generator operations. Auto-activating skill for Technical Documentation. Triggers on: deprecation notice generator, deprecation notice generator Part of the Technical Documentation skill category. Use when working with deprecation notice generator fun…
go
Design Doc Template
Build Doc Template - Auto-activating skill for Technical Documentation. Triggers on: design doc template, design doc template Part of the Technical Documentation skill category. Use when working with design doc template functionality. Trigger with phrases like "design doc templa…
go
Docusaurus Config Setup
Configure docusaurus config setup operations. Auto-activating skill for Technical Documentation. Triggers on: docusaurus config setup, docusaurus config setup Part of the Technical Documentation skill category. Use when configuring systems or services. Trigger with phrases like …
go
Faq Generator
Generate faq generator operations. Auto-activating skill for Technical Documentation. Triggers on: faq generator, faq generator Part of the Technical Documentation skill category. Use when working with faq generator functionality. Trigger with phrases like "faq generator", "faq …
go
Incident Postmortem Template
Manage incident postmortem template operations. Auto-activating skill for Technical Documentation. Triggers on: incident postmortem template, incident postmortem template Part of the Technical Documentation skill category. Use when working with incident postmortem template funct…
go
Installation Guide Creator
Create installation guide creator operations. Auto-activating skill for Technical Documentation. Triggers on: installation guide creator, installation guide creator Part of the Technical Documentation skill category. Use when working with installation guide creator functionality…
go
Jsdoc Comment Generator
Generate jsdoc comment generator operations. Auto-activating skill for Technical Documentation. Triggers on: jsdoc comment generator, jsdoc comment generator Part of the Technical Documentation skill category. Use when working with jsdoc comment generator functionality. Trigger …
go
Migration Guide Creator
Create migration guide creator operations. Auto-activating skill for Technical Documentation. Triggers on: migration guide creator, migration guide creator Part of the Technical Documentation skill category. Use when working with migration guide creator functionality. Trigger wi…
go
Mkdocs Config Generator
Generate mkdocs config generator operations. Auto-activating skill for Technical Documentation. Triggers on: mkdocs config generator, mkdocs config generator Part of the Technical Documentation skill category. Use when configuring systems or services. Trigger with phrases like "…
go
Quickstart Guide Generator
Generate quickstart guide generator operations. Auto-activating skill for Technical Documentation. Triggers on: quickstart guide generator, quickstart guide generator Part of the Technical Documentation skill category. Use when working with quickstart guide generator functionali…
go
Runbook Creator
Create runbook creator operations. Auto-activating skill for Technical Documentation. Triggers on: runbook creator, runbook creator Part of the Technical Documentation skill category. Use when working with runbook creator functionality. Trigger with phrases like "runbook creator…
go
Sdk Documentation Generator
Generate sdk documentation generator operations. Auto-activating skill for Technical Documentation. Triggers on: sdk documentation generator, sdk documentation generator Part of the Technical Documentation skill category. Use when working with sdk documentation generator functio…
go
Troubleshooting Guide Creator
Create troubleshooting guide creator operations. Auto-activating skill for Technical Documentation. Triggers on: troubleshooting guide creator, troubleshooting guide creator Part of the Technical Documentation skill category. Use when working with troubleshooting guide creator f…
go
Tutorial Outline Creator
Create tutorial outline creator operations. Auto-activating skill for Technical Documentation. Triggers on: tutorial outline creator, tutorial outline creator Part of the Technical Documentation skill category. Use when working with tutorial outline creator functionality. Trigge…
go
Vitepress Config Creator
Create vitepress config creator operations. Auto-activating skill for Technical Documentation. Triggers on: vitepress config creator, vitepress config creator Part of the Technical Documentation skill category. Use when configuring systems or services. Trigger with phrases like …
go
Api Flow Diagram Creator
Create api flow diagram creator operations. Auto-activating skill for Visual Content. Triggers on: api flow diagram creator, api flow diagram creator Part of the Visual Content skill category. Use when working with APIs or building integrations. Trigger with phrases like "api fl…
goapi
Architecture Diagram Creator
Create architecture diagram creator operations. Auto-activating skill for Visual Content. Triggers on: architecture diagram creator, architecture diagram creator Part of the Visual Content skill category. Use when working with architecture diagram creator functionality. Trigger …
go
Ascii Art Diagram Creator
Create ascii art diagram creator operations. Auto-activating skill for Visual Content. Triggers on: ascii art diagram creator, ascii art diagram creator Part of the Visual Content skill category. Use when working with ascii art diagram creator functionality. Trigger with phrases…
go
Chart Js Config Creator
Create chart js config creator operations. Auto-activating skill for Visual Content. Triggers on: chart js config creator, chart js config creator Part of the Visual Content skill category. Use when configuring systems or services. Trigger with phrases like "chart js config crea…
go
D2 Diagram Creator
Create d2 diagram creator operations. Auto-activating skill for Visual Content. Triggers on: d2 diagram creator, d2 diagram creator Part of the Visual Content skill category. Use when working with d2 diagram creator functionality. Trigger with phrases like "d2 diagram creator", …
go
Data Visualization Helper
Configure with data visualization helper operations. Auto-activating skill for Visual Content. Triggers on: data visualization helper, data visualization helper Part of the Visual Content skill category. Use when working with data visualization helper functionality. Trigger with…
go
Database Schema Visualizer
Generate database schema visualizer operations. Auto-activating skill for Visual Content. Triggers on: database schema visualizer, database schema visualizer Part of the Visual Content skill category. Use when working with database schema visualizer functionality. Trigger with p…
go
Graphviz Dot Generator
Generate graphviz dot generator operations. Auto-activating skill for Visual Content. Triggers on: graphviz dot generator, graphviz dot generator Part of the Visual Content skill category. Use when working with graphviz dot generator functionality. Trigger with phrases like "gra…
go
Infographic Outline Creator
Create infographic outline creator operations. Auto-activating skill for Visual Content. Triggers on: infographic outline creator, infographic outline creator Part of the Visual Content skill category. Use when working with infographic outline creator functionality. Trigger with…
go
Mermaid Class Diagram Generator
Generate mermaid class diagram generator operations. Auto-activating skill for Visual Content. Triggers on: mermaid class diagram generator, mermaid class diagram generator Part of the Visual Content skill category. Use when working with mermaid class diagram generator functiona…
goai
Mermaid Er Diagram Creator
Create mermaid er diagram creator operations. Auto-activating skill for Visual Content. Triggers on: mermaid er diagram creator, mermaid er diagram creator Part of the Visual Content skill category. Use when working with mermaid er diagram creator functionality. Trigger with phr…
goai
Mermaid Flowchart Generator
Generate mermaid flowchart generator operations. Auto-activating skill for Visual Content. Triggers on: mermaid flowchart generator, mermaid flowchart generator Part of the Visual Content skill category. Use when working with mermaid flowchart generator functionality. Trigger wi…
goai
Mermaid Gantt Chart Generator
Generate mermaid gantt chart generator operations. Auto-activating skill for Visual Content. Triggers on: mermaid gantt chart generator, mermaid gantt chart generator Part of the Visual Content skill category. Use when working with mermaid gantt chart generator functionality. Tr…
goai
Mermaid Sequence Diagram Creator
Create mermaid sequence diagram creator operations. Auto-activating skill for Visual Content. Triggers on: mermaid sequence diagram creator, mermaid sequence diagram creator Part of the Visual Content skill category. Use when working with mermaid sequence diagram creator functio…
goai
Mermaid State Diagram Creator
Create mermaid state diagram creator operations. Auto-activating skill for Visual Content. Triggers on: mermaid state diagram creator, mermaid state diagram creator Part of the Visual Content skill category. Use when working with mermaid state diagram creator functionality. Trig…
goai
Mindmap Generator
Generate mindmap generator operations. Auto-activating skill for Visual Content. Triggers on: mindmap generator, mindmap generator Part of the Visual Content skill category. Use when working with mindmap generator functionality. Trigger with phrases like "mindmap generator", "mi…
go
Network Diagram Generator
Generate network diagram generator operations. Auto-activating skill for Visual Content. Triggers on: network diagram generator, network diagram generator Part of the Visual Content skill category. Use when working with network diagram generator functionality. Trigger with phras…
go
Org Chart Creator
Create org chart creator operations. Auto-activating skill for Visual Content. Triggers on: org chart creator, org chart creator Part of the Visual Content skill category. Use when working with org chart creator functionality. Trigger with phrases like "org chart creator", "org …
go
Plantuml Diagram Generator
Generate plantuml diagram generator operations. Auto-activating skill for Visual Content. Triggers on: plantuml diagram generator, plantuml diagram generator Part of the Visual Content skill category. Use when working with plantuml diagram generator functionality. Trigger with p…
go
Plotly Chart Generator
Generate plotly chart generator operations. Auto-activating skill for Visual Content. Triggers on: plotly chart generator, plotly chart generator Part of the Visual Content skill category. Use when working with plotly chart generator functionality. Trigger with phrases like "plo…
go
Presentation Slide Outliner
Manage presentation slide outliner operations. Auto-activating skill for Visual Content. Triggers on: presentation slide outliner, presentation slide outliner Part of the Visual Content skill category. Use when working with presentation slide outliner functionality. Trigger with…
go
Process Flow Generator
Process Flow Generator - Auto-activating skill for Visual Content. Triggers on: process flow generator, process flow generator Part of the Visual Content skill category. Use when working with process flow generator functionality. Trigger with phrases like "process flow generator…
go
Svg Icon Generator
Generate svg icon generator operations. Auto-activating skill for Visual Content. Triggers on: svg icon generator, svg icon generator Part of the Visual Content skill category. Use when working with svg icon generator functionality. Trigger with phrases like "svg icon generator"…
go
Technical Diagram Analyzer
Analyze technical diagram analyzer operations. Auto-activating skill for Visual Content. Triggers on: technical diagram analyzer, technical diagram analyzer Part of the Visual Content skill category. Use when analyzing or auditing technical diagram analyzer. Trigger with phrases…
go
User Journey Mapper
Manage user journey mapper operations. Auto-activating skill for Visual Content. Triggers on: user journey mapper, user journey mapper Part of the Visual Content skill category. Use when working with user journey mapper functionality. Trigger with phrases like "user journey mapp…
go
Approval Workflow Generator
Generate approval workflow generator operations. Auto-activating skill for Business Automation. Triggers on: approval workflow generator, approval workflow generator Part of the Business Automation skill category. Use when working with approval workflow generator functionality. …
goautomation
Batch File Processor
Process batch file processor operations. Auto-activating skill for Business Automation. Triggers on: batch file processor, batch file processor Part of the Business Automation skill category. Use when working with batch file processor functionality. Trigger with phrases like "ba…
goautomation
Calendar Event Creator
Create calendar event creator operations. Auto-activating skill for Business Automation. Triggers on: calendar event creator, calendar event creator Part of the Business Automation skill category. Use when working with calendar event creator functionality. Trigger with phrases l…
goautomation
Csv Processor
Process csv processor operations. Auto-activating skill for Business Automation. Triggers on: csv processor, csv processor Part of the Business Automation skill category. Use when working with csv processor functionality. Trigger with phrases like "csv processor", "csv processor…
goautomation
Discord Bot Generator
Generate discord bot generator operations. Auto-activating skill for Business Automation. Triggers on: discord bot generator, discord bot generator Part of the Business Automation skill category. Use when working with discord bot generator functionality. Trigger with phrases lik…
godiscordautomation
Document Merger
Manage document merger operations. Auto-activating skill for Business Automation. Triggers on: document merger, document merger Part of the Business Automation skill category. Use when working with document merger functionality. Trigger with phrases like "document merger", "docu…
goautomation
Email Parser
Configure and manage - Parse email parser operations. Auto-activating skill for Business Automation. Triggers on: email parser, email parser Part of the Business Automation skill category. Use when working with email parser functionality. Trigger with phrases like "email parser"…
goautomationai
Excel Formula Generator
Generate excel formula generator operations. Auto-activating skill for Business Automation. Triggers on: excel formula generator, excel formula generator Part of the Business Automation skill category. Use when working with excel formula generator functionality. Trigger with phr…
goautomation
Excel Macro Creator
Create excel macro creator operations. Auto-activating skill for Business Automation. Triggers on: excel macro creator, excel macro creator Part of the Business Automation skill category. Use when working with excel macro creator functionality. Trigger with phrases like "excel m…
goautomation
Form Builder Helper
Build form builder helper operations. Auto-activating skill for Business Automation. Triggers on: form builder helper, form builder helper Part of the Business Automation skill category. Use when working with form builder helper functionality. Trigger with phrases like "form bui…
goautomation
Google Sheets Automation
Manage google sheets automation operations. Auto-activating skill for Business Automation. Triggers on: google sheets automation, google sheets automation Part of the Business Automation skill category. Use when working with google sheets automation functionality. Trigger with p…
goautomation
Invoice Generator
Generate invoice generator operations. Auto-activating skill for Business Automation. Triggers on: invoice generator, invoice generator Part of the Business Automation skill category. Use when working with invoice generator functionality. Trigger with phrases like "invoice gener…
goautomation
Make Scenario Creator
Create make scenario creator operations. Auto-activating skill for Business Automation. Triggers on: make scenario creator, make scenario creator Part of the Business Automation skill category. Use when working with make scenario creator functionality. Trigger with phrases like …
goautomation
Meeting Scheduler Helper
Configure with meeting scheduler helper operations. Auto-activating skill for Business Automation. Triggers on: meeting scheduler helper, meeting scheduler helper Part of the Business Automation skill category. Use when working with meeting scheduler helper functionality. Trigge…
goautomation
N8n Workflow Generator
Generate n8n workflow generator operations. Auto-activating skill for Business Automation. Triggers on: n8n workflow generator, n8n workflow generator Part of the Business Automation skill category. Use when working with n8n workflow generator functionality. Trigger with phrases…
goautomation
Notification Dispatcher
Manage notification dispatcher operations. Auto-activating skill for Business Automation. Triggers on: notification dispatcher, notification dispatcher Part of the Business Automation skill category. Use when working with notification dispatcher functionality. Trigger with phras…
goautomation
Pdf Generator
Generate pdf generator operations. Auto-activating skill for Business Automation. Triggers on: pdf generator, pdf generator Part of the Business Automation skill category. Use when working with pdf generator functionality. Trigger with phrases like "pdf generator", "pdf generato…
goautomation
Pdf Parser
Configure and manage - Parse pdf parser operations. Auto-activating skill for Business Automation. Triggers on: pdf parser, pdf parser Part of the Business Automation skill category. Use when working with pdf parser functionality. Trigger with phrases like "pdf parser", "pdf par…
goautomation
Reminder System Creator
Create reminder system creator operations. Auto-activating skill for Business Automation. Triggers on: reminder system creator, reminder system creator Part of the Business Automation skill category. Use when working with reminder system creator functionality. Trigger with phras…
goautomation
Report Generator
Generate report generator operations. Auto-activating skill for Business Automation. Triggers on: report generator, report generator Part of the Business Automation skill category. Use when working with report generator functionality. Trigger with phrases like "report generator"…
goautomation
Slack Bot Creator
Create slack bot creator operations. Auto-activating skill for Business Automation. Triggers on: slack bot creator, slack bot creator Part of the Business Automation skill category. Use when working with slack bot creator functionality. Trigger with phrases like "slack bot creat…
goslackautomation
Survey Creator
Create survey creator operations. Auto-activating skill for Business Automation. Triggers on: survey creator, survey creator Part of the Business Automation skill category. Use when working with survey creator functionality. Trigger with phrases like "survey creator", "survey cr…
goautomation
Teams Webhook Sender
Manage teams webhook sender operations. Auto-activating skill for Business Automation. Triggers on: teams webhook sender, teams webhook sender Part of the Business Automation skill category. Use when working with teams webhook sender functionality. Trigger with phrases like "tea…
goautomation
Zapier Integration Helper
Assist with zapier integration helper operations. Auto-activating skill for Business Automation. Triggers on: zapier integration helper, zapier integration helper Part of the Business Automation skill category. Use when working with APIs or building integrations. Trigger with ph…
goautomationapi
Acceptance Criteria Creator
Create acceptance criteria creator operations. Auto-activating skill for Enterprise Workflows. Triggers on: acceptance criteria creator, acceptance criteria creator Part of the Enterprise Workflows skill category. Use when working with acceptance criteria creator functionality. …
go
Asana Task Creator
Create asana task creator operations. Auto-activating skill for Enterprise Workflows. Triggers on: asana task creator, asana task creator Part of the Enterprise Workflows skill category. Use when working with asana task creator functionality. Trigger with phrases like "asana tas…
go
Audit Trail Helper
Audit Trail Helper - Auto-activating skill for Enterprise Workflows. Triggers on: audit trail helper, audit trail helper Part of the Enterprise Workflows skill category. Use when analyzing or auditing audit trail helper. Trigger with phrases like "audit trail helper", "audit hel…
goai
Backlog Grooming Assistant
Execute backlog grooming assistant operations. Auto-activating skill for Enterprise Workflows. Triggers on: backlog grooming assistant, backlog grooming assistant Part of the Enterprise Workflows skill category. Use when working with backlog grooming assistant functionality. Tri…
go
Change Request Generator
Generate change request generator operations. Auto-activating skill for Enterprise Workflows. Triggers on: change request generator, change request generator Part of the Enterprise Workflows skill category. Use when working with change request generator functionality. Trigger wi…
go
Confluence Page Generator
Generate confluence page generator operations. Auto-activating skill for Enterprise Workflows. Triggers on: confluence page generator, confluence page generator Part of the Enterprise Workflows skill category. Use when working with confluence page generator functionality. Trigge…
go
Definition Of Done Generator
Generate definition of done generator operations. Auto-activating skill for Enterprise Workflows. Triggers on: definition of done generator, definition of done generator Part of the Enterprise Workflows skill category. Use when working with definition of done generator functiona…
go
Executive Summary Creator
Create executive summary creator operations. Auto-activating skill for Enterprise Workflows. Triggers on: executive summary creator, executive summary creator Part of the Enterprise Workflows skill category. Use when working with executive summary creator functionality. Trigger …
go
Github Issue Creator
Create github issue creator operations. Auto-activating skill for Enterprise Workflows. Triggers on: github issue creator, github issue creator Part of the Enterprise Workflows skill category. Use when working with github issue creator functionality. Trigger with phrases like "g…
gogithub
Github Project Setup
Configure github project setup operations. Auto-activating skill for Enterprise Workflows. Triggers on: github project setup, github project setup Part of the Enterprise Workflows skill category. Use when working with github project setup functionality. Trigger with phrases like…
gogithub
Gitlab Epic Creator
Create gitlab epic creator operations. Auto-activating skill for Enterprise Workflows. Triggers on: gitlab epic creator, gitlab epic creator Part of the Enterprise Workflows skill category. Use when working with gitlab epic creator functionality. Trigger with phrases like "gitla…
gogitlab
Governance Checklist Generator
Generate governance checklist generator operations. Auto-activating skill for Enterprise Workflows. Triggers on: governance checklist generator, governance checklist generator Part of the Enterprise Workflows skill category. Use when working with governance checklist generator f…
go
Impact Analysis Helper
Configure with impact analysis helper operations. Auto-activating skill for Enterprise Workflows. Triggers on: impact analysis helper, impact analysis helper Part of the Enterprise Workflows skill category. Use when working with impact analysis helper functionality. Trigger with…
go
Jira Ticket Generator
Generate jira ticket generator operations. Auto-activating skill for Enterprise Workflows. Triggers on: jira ticket generator, jira ticket generator Part of the Enterprise Workflows skill category. Use when working with jira ticket generator functionality. Trigger with phrases l…
gojira
Jira Workflow Creator
Create jira workflow creator operations. Auto-activating skill for Enterprise Workflows. Triggers on: jira workflow creator, jira workflow creator Part of the Enterprise Workflows skill category. Use when working with jira workflow creator functionality. Trigger with phrases lik…
gojira
Kpi Dashboard Template
Manage kpi dashboard template operations. Auto-activating skill for Enterprise Workflows. Triggers on: kpi dashboard template, kpi dashboard template Part of the Enterprise Workflows skill category. Use when working with kpi dashboard template functionality. Trigger with phrases…
go
Linear Issue Generator
Generate linear issue generator operations. Auto-activating skill for Enterprise Workflows. Triggers on: linear issue generator, linear issue generator Part of the Enterprise Workflows skill category. Use when working with linear issue generator functionality. Trigger with phras…
golinear
Okr Tracker Creator
Create okr tracker creator operations. Auto-activating skill for Enterprise Workflows. Triggers on: okr tracker creator, okr tracker creator Part of the Enterprise Workflows skill category. Use when working with okr tracker creator functionality. Trigger with phrases like "okr t…
go
Risk Assessment Creator
Create risk assessment creator operations. Auto-activating skill for Enterprise Workflows. Triggers on: risk assessment creator, risk assessment creator Part of the Enterprise Workflows skill category. Use when working with risk assessment creator functionality. Trigger with phr…
go
Roadmap Generator
Generate roadmap generator operations. Auto-activating skill for Enterprise Workflows. Triggers on: roadmap generator, roadmap generator Part of the Enterprise Workflows skill category. Use when working with roadmap generator functionality. Trigger with phrases like "roadmap gen…
go
Sla Monitor Setup
Configure sla monitor setup operations. Auto-activating skill for Enterprise Workflows. Triggers on: sla monitor setup, sla monitor setup Part of the Enterprise Workflows skill category. Use when monitoring systems or services. Trigger with phrases like "sla monitor setup", "sla…
gomonitoring
Sprint Planning Helper
Configure with sprint planning helper operations. Auto-activating skill for Enterprise Workflows. Triggers on: sprint planning helper, sprint planning helper Part of the Enterprise Workflows skill category. Use when working with sprint planning helper functionality. Trigger with…
go
Stakeholder Communication Template
Manage stakeholder communication template operations. Auto-activating skill for Enterprise Workflows. Triggers on: stakeholder communication template, stakeholder communication template Part of the Enterprise Workflows skill category. Use when working with stakeholder communicat…
go
Status Report Generator
Generate status report generator operations. Auto-activating skill for Enterprise Workflows. Triggers on: status report generator, status report generator Part of the Enterprise Workflows skill category. Use when working with status report generator functionality. Trigger with p…
go
User Story Generator
Generate user story generator operations. Auto-activating skill for Enterprise Workflows. Triggers on: user story generator, user story generator Part of the Enterprise Workflows skill category. Use when working with user story generator functionality. Trigger with phrases like …
go
Launch
Launch Day Autopilot — prepare everything for a product launch. Use when user wants to launch, go live, announce, or prepare for Product Hunt / Hacker News / social media launch.
go
Receiving Code Review
Use when receiving code review feedback, before implementing suggestions, especially if feedback seems unclear or technically questionable - requires technical rigor and verification, not performative agreement or blind implementation
go
Ship Gate
Turn the /ship scorecard into a blocking, config-as-code quality gate. Sets per-category score thresholds, hard-fails on leaked secrets or critical findings, and wires the gate into a pre-push hook and CI so nothing below the bar merges. Use when the user wants a merge gate, CI …
goai
Browse more topics
agentagent-skillsaiansibleanthropicapiarchitectureattestationauditautomationawsazurebenchmarkingbisectbrowserbuildcaptionschangelogchartsciclaudecleanupcloudflarecode-qualitycode-reviewcommitcompliancecomposecontainerscontentcontextcoveragecracsvd3datadatabasedebuggingdependenciesdeploymentdevelopmentdevopsdevtoolsdiagramsdiscorddjangodockerdocumentationdocumentsdocxdorae2eefficiencyembeddingengineering-code-qualityenvironmenteu-regulationevidenceexcelexplainerexplanationfaviconfilesflaskfrontendgcpgdprgitgithubgitlabgographqlhookshygieneimagesincident-responseindexesinfrastructureiosjavascriptjirakotlinkuberneteslearninglinearlintingllmmaintenancemcpmemorymermaidmetameta-tagsmigrationmigrationsmobilemonitoringmonorepomysqlnextjsnis2nodenpmofficialonboardingopenapioptimizationowasppackagesparsingpatternspdfperformanceplanningplaywrightpostgrespowerpointpptxprprivacyproductivityprofilingprotocolprototypingpwapythonqaquery-optimizationragrapid-developmentreactredisrefactoringregexregressionreleasereportsrestreviewrustsafetyschemascrapingsdksdlcsecuritysemverserversetupskillsslackslidesspreadsheetssqlsqliteswaggerswifttddteachingtest-generationtestingthreat-modelingtokenstranscripttypescriptutilityvalidationvercelversioningvibe-codingvideovisualizationvuevulnerabilitiesvulnerability-managementwebwordworkflowworkflowsworkspacexcodexlsxyoutube