Back to All Skills
Best Claude Code Skills for Ai
285 skills tagged with “ai”
Skyvern Browser Automation
AI-powered browser automation — navigate sites, fill forms, extract structured data, log in with stored credentials, and build reusable workflows
browserautomationscrapingai+1
Claude Api
Reference for the Claude API / Anthropic SDK — model ids, pricing, params, streaming, tool use, MCP, agents, caching, token counting, model migration. TRIGGER — read BEFORE opening the target file; don't skip because it "looks like a one-liner" — whenever: the prompt names Claud…
goapiaillm+2
Pptx
Use this skill any time a .pptx file is involved in any way — as input, output, or both. This includes: creating slide decks, pitch decks, or presentations; reading, parsing, or extracting text from any .pptx file (even if the extracted content will be used elsewhere, like in an…
ai
Slack Gif Creator
Knowledge and utilities for creating animated GIFs optimized for Slack. Provides constraints, validation tools, and animation concepts. Use when users request animated GIFs for Slack like "make me a GIF of X doing Y for Slack."
slackai
Web Artifacts Builder
Suite of tools for creating elaborate, multi-component claude.ai HTML artifacts using modern frontend web technologies (React, Tailwind CSS, shadcn/ui). Use for complex artifacts requiring state management, routing, or shadcn/ui components - not for simple single-file HTML/JSX a…
reactai
Sales Engineer
Analyzes RFP/RFI responses for coverage gaps, builds competitive feature comparison matrices, and plans proof-of-concept (POC) engagements for pre-sales engineering. Use when responding to RFPs, bids, or proposal requests; comparing product features against competitors; planning…
airag
Capacity Planner
Use when an ops leader (Director of CX, Head of Support, VP Ops, Head of BizOps, Head of IT ops, Head of Finance ops) is sizing ops capacity, building a headcount plan, modeling utilization risk, planning Q3 capacity or annual support capacity, or designing CS coverage — and nee…
airag
Internal Comms
Use when a Head of People Ops, BizOps lead, or Internal Communications owner needs to draft and sequence an internal-only change-management communication — a re-org announcement, a tool rollout, a policy change, a leadership transition, a layoff, an acquisition close, or an inte…
pythonai
Knowledge Ops
Use when a Head of Ops, Knowledge Manager, or TPM-Internal needs to author, validate, or clean up company SOPs and internal runbooks (procurement intake, vendor offboarding, incident-comms cascade, employee onboarding) — including 5W2H completeness checks (Who-What-When-Where-Wh…
pythongoai
Process Mapper
Use when a BizOps lead, COO, or process-improvement owner needs to document an end-to-end business process (procurement, employee onboarding, incident handoff, customer-onboarding, claims adjudication) in BPMN-style notation, measure cycle times by stage, surface where work spen…
pythonai
Procurement Optimizer
Use when running an annual SaaS audit, doing category-level spend review, or rationalizing the supplier base — when the user needs a spend audit, spend categorization (UNSPSC-aligned with Pareto breakdown and industry profiles), purchasing-cycle analysis (bottleneck categories p…
goai
Vendor Management
Use when reviewing, scoring, or auditing third-party SaaS / vendor relationships — running a vendor scorecard with industry tuning, tracking SLA compliance with credit-claim flags, classifying third-party risk across 4 risk vectors, preparing a tier-1 vendor review, or auditing …
performanceai
Boardroom
/cs:boardroom <brief> — 6-phase multi-role deliberation across the C-suite with Phase 2 isolation, critic pre-screen, and synthesis. Outputs a board memo. Use when a decision spans multiple executive domains — e.g. a pricing change touching finance, positioning, and product, or …
ai
C Level Agents
Founder-mode executive team. 13 cs-* C-suite agents (CFO, CMO, CRO, CPO, COO, CHRO, CISO, GC, CDO, CAIO, CCO, VPE, Chief of Staff) and 21 /cs:* slash commands for forcing-question office hours, multi-role boardroom deliberation, strategic sprint pipeline, and meta routing. Use w…
aiagent
Caio Review
/cs:caio-review <plan> — Eval-demanding Chief AI Officer interrogation of any plan that involves AI: model selection, risk classification, cost economics, or AI hiring. Use when shipping an AI feature without an eval set, choosing between API, fine-tune, and self-hosted, or clas…
apiai
Cdo Review
/cs:cdo-review <plan> — Decision-driven Chief Data Officer interrogation of any plan that touches training data, data architecture, data productization, or data team hiring. Use when validating training-data rights before model work, choosing warehouse vs lakehouse vs mesh, or v…
ai
Cfo Review
/cs:cfo-review <plan> — Numerate-skeptic interrogation of any plan that touches money. Unit economics, runway, dilution, capital allocation. Use when a plan commits meaningful spend — e.g. a hiring wave, a fundraise decision, or a new channel budget.
apiai
Cmo Review
/cs:cmo-review <plan> — Narrative-first interrogation of positioning, ICP, message house, and channel mix. Use when launching a campaign or repositioning, or when CAC is rising and the one-sentence positioning test fails.
ai
Cpo Review
/cs:cpo-review <plan> — JTBD-driven interrogation of product roadmap, PMF signal, and portfolio focus. Use when committing a quarter's roadmap, deciding whether to kill a feature, or claiming PMF without a retention curve.
ai
Cross Eval
/cs:cross-eval <memo> — Multi-model consensus on a board memo or strategy brief. Claude + Codex + Gemini cross-review with graceful degradation. Use when a high-stakes memo needs an independent sanity check before the boardroom — e.g. a bet-the-company pivot or fundraise terms.
ai
Cto Review
/cs:cto-review <plan> — Architecture and scaling interrogation. Tech debt, scaling cliffs, team scaling, build-vs-buy. Use when committing to an architecture, planning for 10x load, or weighing a rebuild against a vendor.
ai
Onboard
/cs:onboard — Founder interview that populates ~/.claude/company-context.md using the canonical 7-dimension cs-onboard schema. The first command to run when starting with c-level-agents. Use when setting up the virtual C-suite for a new company, or when advisors lack company con…
aiagent
Post Mortem
/cs:post-mortem <decision> — Honest retrospective on an executed decision, scored against original assumptions and dissent. Closes the strategic sprint loop. Use when a decision hits its 90-day review checkpoint or its kill criteria trigger — e.g. scoring last quarter's pricing …
ai
Chief Ai Officer Advisor
Chief AI Officer advisory for startups: model build-vs-buy decisions (API vs fine-tune vs in-house), AI risk classification under EU AI Act + US state patchwork, AI cost economics (API-to-self-hosted breakeven), and AI team org evolution. Use when deciding whether to call an API…
goapiai
Chief Data Officer Advisor
Chief Data Officer advisory for startups: AI training data rights and consent provenance, data product strategy (warehouse vs lakehouse vs mesh, build-vs-buy), B2B customer-data-as-asset valuation and M&A readiness, data team org evolution. Use when deciding whether to train mod…
ai
Board Prep
Board meeting preparation for the adversarial scenario, not the friendly one. Forces numbers-cold mastery, anticipates hard questions, builds a narrative that acknowledges weakness without losing the room. Use when preparing for a board meeting, an investor update, fundraising p…
ai
Hard Call
/em:hard-call — Framework for decisions with no good options. Use when every option is painful and a structured 10/10/10 + regret-minimization pass is needed — e.g. choosing between a layoff and a down round, or killing a beloved product line.
goai
Postmortem
/em:postmortem — Honest analysis of what went wrong. Use after a failed launch, missed quarter, or bad hire to run a blameless 5-Whys retrospective with a change register — e.g. dissecting why the Q3 release slipped six weeks.
ai
Board Deck Builder
Assembles comprehensive board and investor update decks by pulling perspectives from all C-suite roles. Use when preparing board meetings, investor updates, quarterly business reviews, or fundraising narratives. Covers structure, narrative framework, bad news delivery, and commo…
ai
C Level Skills
Index and router for the C-level advisory bundle: 33 skills covering 14 C-suite roles, orchestration, cross-cutting capabilities, and culture. Use when exploring what the c-level-advisor bundle contains, deciding which advisor skill fits a question, or finding the entry points (…
ai
Ceo Advisor
Executive leadership guidance for strategic decision-making, organizational development, and stakeholder management. Use when planning strategy, preparing board presentations, managing investors, developing organizational culture, making executive decisions, fundraising, or when…
ai
Cfo Advisor
Financial leadership for startups and scaling companies. Financial modeling, unit economics, fundraising strategy, cash management, and board financial packages. Use when building financial models, analyzing unit economics, planning fundraising, managing cash runway, preparing b…
ai
Chief Of Staff
C-suite orchestration layer. Routes founder questions to the right advisor role(s), triggers multi-role board meetings for complex decisions, synthesizes outputs, and tracks decisions. Every C-suite interaction starts here. Loads company context automatically. Use when a founder…
ai
Competitive Intel
Systematic competitor tracking that feeds CMO positioning, CRO battlecards, and CPO roadmap decisions. Use when analyzing competitors, building sales battlecards, tracking market moves, positioning against alternatives, or when user mentions competitive intelligence, competitive…
ai
Cs Onboard
Founder onboarding interview that captures company context across 7 dimensions. Invoke with /cs:setup for initial interview or /cs:update for quarterly refresh. Generates ~/.claude/company-context.md used by all C-suite advisor skills. Use when setting up the C-suite advisors fo…
ai
Internal Narrative
Build and maintain one coherent company story across all audiences — employees, investors, customers, candidates, and partners. Detects narrative contradictions and ensures the same truth is framed for each audience's needs. Use when preparing investor updates, all-hands present…
ai
Channel Economics
Use when reviewing or rebalancing direct vs. partner-led channel economics — computing fully-loaded cost-to-serve per channel, channel ROI with cash / LTV / marginal lenses, and optimal channel mix subject to constraints. For Head of Commercial, RevOps, and VP Sales doing quarte…
ai
Deal Desk
Use when reviewing a specific inbound deal before close — when sales has asked for a discount that exceeds AE authority, when the customer has redlined the MSA, when per-deal economics (margin after discount, multi-year payment shape, indemnity exposure) need to be quantified, o…
ai
Partnerships Architect
Use when a startup is approached by a prospective partner and someone has to decide should we sign this partner, at what partner tier (referral / reseller / OEM / SI-consulting / strategic alliance), with what joint GTM commitment, and at what revshare. Classifies partner tier f…
ai
Rfp Responder
Use when an RFP, RFI, RFQ, security questionnaire, vendor questionnaire, or proposal request arrives and the team needs a structured response — parsing multi-section buyer-dictated requirements (MANDATORY vs WEIGHTED vs NICE-TO-HAVE), building a Shipley-method proof-point matrix…
securityai
Ai Act Readiness
/cs:ai-act-readiness <system> — EU AI Act 6-question forcing interrogation. Use during AI-system intake, before EU deployment, or during annual compliance refresh as Article 113 obligations phase in (2025-02-02 / 2025-08-02 / 2026-08-02 / 2027-08-02).
deploymentai
Aims Audit
/cs:aims-audit <scope> — ISO/IEC 42001 AIMS internal-audit 6-question forcing interrogation. Use before certification stage 1, before annual internal audit cycles, or when onboarding a new AI system into an existing AIMS.
ai
Compliance Os
Compliance OS — meta-orchestrator that lets compliance teams CONFIGURE which frameworks apply, COMPUTE cross-framework control overlap, SIMULATE internal audits, and CONSOLIDATE evidence across multiple frameworks. Four decisions: (1) Given a company profile, which of the 12 sup…
ai
A11y Audit
Accessibility audit skill for scanning, fixing, and verifying WCAG 2.2 Level A and AA compliance across React, Next.js, Vue, Angular, Svelte, and plain HTML codebases. Use when auditing accessibility, fixing a11y violations, checking color contrast, generating compliance reports…
reactvueai
Google Workspace Cli
Google Workspace administration via the gws CLI (github.com/googleworkspace/cli). Install, authenticate, and automate Gmail, Drive, Sheets, Calendar, Docs, Chat, and Tasks. Run security audits and use local recipe templates and persona bundles. Use for Google Workspace admin, gw…
gogithubsecurityautomation+1
Fix
Fix failing or flaky Playwright tests. Use when user says "fix test", "flaky test", "test failing", "debug test", "test broken", "test passes sometimes", or "intermittent failure".
ai
Playwright Pro
Production-grade Playwright testing toolkit. Use when the user mentions Playwright tests, end-to-end testing, browser automation, fixing flaky tests, test migration, CI/CD testing, or test suites. Generate tests, fix flaky failures, migrate from Cypress/Selenium, sync with TestR…
testingbrowserautomationai+1
Testrail
Sync tests with TestRail. Use when user mentions "testrail", "test management", "test cases", "test run", "sync test cases", "push results to testrail", or "import from testrail".
ai
Ai Security
Use when assessing AI/ML systems for prompt injection, jailbreak vulnerabilities, model inversion risk, data poisoning exposure, or agent tool abuse. Covers MITRE ATLAS technique mapping, injection signature detection, and adversarial robustness scoring.
securityaiagent
Email Template Builder
Build complete transactional email systems: React Email templates, provider integration (Resend, Postmark, SendGrid, AWS SES), preview server, i18n support, dark mode, spam optimization, analytics tracking. Use when adding transactional email to a new product, migrating between …
reactawsai
Engineering Skills
Index of the engineering-team skills bundle for Claude Code, Codex, Gemini CLI, Cursor, OpenClaw, and 6 more tools. Architecture, frontend, backend, QA, DevOps, security, AI/ML, data engineering, Playwright, Stripe, AWS, MS365 (stdlib-only Python tools). Use when browsing or cho…
pythonawssecurityai
Epic Design
Build immersive, cinematic 2.5D interactive websites using scroll storytelling, parallax depth, text animations, and premium scroll effects — no WebGL required. Use this skill for any web design task: landing pages, product sites, hero sections, scroll animations, parallax, stic…
goai
Red Team
Use when planning or executing authorized red team engagements, attack path analysis, or offensive security simulations. Covers MITRE ATT&CK kill-chain planning, technique scoring, choke point identification, OPSEC risk assessment, and crown jewel targeting.
securityai
Senior Architect
This skill should be used when the user asks to "design system architecture", "evaluate microservices vs monolith", "create architecture diagrams", "analyze dependencies", "choose a database", "plan for scalability", "make technical decisions", or "review system design". Use for…
ai
Senior Computer Vision
Computer vision engineering skill for object detection, image segmentation, and visual AI systems. Covers CNN and Vision Transformer architectures, YOLO/Faster R-CNN/DETR detection, Mask R-CNN/SAM segmentation, and production deployment with ONNX/TensorRT. Includes PyTorch, torc…
deploymentai
Senior Data Engineer
Data engineering skill for building scalable data pipelines, ETL/ELT systems, and data infrastructure. Expertise in Python, SQL, Spark, Airflow, dbt, Kafka, and modern data stack. Includes data modeling, pipeline orchestration, data quality, and DataOps. Use when designing data …
pythongoai
Senior Devops
Comprehensive DevOps skill for CI/CD, infrastructure automation, containerization, and cloud platforms (AWS, GCP, Azure). Includes pipeline setup, infrastructure as code, deployment automation, and monitoring. Use when setting up pipelines, deploying applications, managing infra…
awsgcpazuredeployment+3
Senior Frontend
Frontend development skill for React, Next.js, TypeScript, and Tailwind CSS applications. Use when building React components, optimizing Next.js performance, analyzing bundle sizes, scaffolding frontend projects, implementing accessibility, or reviewing frontend code quality.
typescriptreactperformanceai
Senior Ml Engineer
ML engineering skill for productionizing models, building MLOps pipelines, and integrating LLMs. Covers model deployment, feature stores, drift monitoring, RAG systems, and cost optimization. Use when the user asks about deploying ML models to production, setting up MLOps infras…
kubernetesdockerperformancedeployment+5
Senior Prompt Engineer
Use when the user asks to optimize prompts, design prompt templates, evaluate LLM outputs with an eval set, measure RAG retrieval quality, validate agent/tool configurations, analyze token usage, or design structured-output contracts. Covers eval-driven prompt iteration, RAG met…
pythonaillmrag+1
Senior Secops
Senior SecOps engineer skill for application security, vulnerability management, compliance verification, and secure development practices. Runs SAST/DAST scans, generates CVE remediation plans, checks dependency vulnerabilities, creates security policies, enforces secure coding…
securityai
Senior Security
Use when the user asks for STRIDE threat modeling, DREAD risk scoring, data-flow-diagram threat analysis, or a quick secret scan — or when a security request needs routing to the right specialist skill (pen-testing, incident response, cloud posture, red team, AI security, threat…
securitytestingai
Snowflake Development
Use when writing Snowflake SQL, building data pipelines with Dynamic Tables or Streams/Tasks, using Cortex AI functions, creating Cortex Agents, writing Snowpark Python, configuring dbt for Snowflake, or troubleshooting Snowflake errors.
pythonaiagent
Run
One-shot lifecycle command that chains init → baseline → spawn → eval → merge in a single invocation. Use when the user runs /hub:run or asks to execute a full AgentHub competition end-to-end.
aiagent
Autoresearch Agent
Autonomous experiment loop that optimizes any file by a measurable metric. Inspired by Karpathy's autoresearch. The agent edits a target file, runs a fixed evaluation, keeps improvements (git commit), discards failures (git reset), and loops indefinitely. Use when: user wants to…
aiagent
Loop
Start an autonomous experiment loop with user-selected interval (10min, 1h, daily, weekly, monthly). Uses CronCreate for scheduling. Use when the user runs /ar:loop or asks to run an autoresearch experiment continuously on a schedule.
ai
Setup
Set up a new autoresearch experiment interactively. Collects domain, target file, eval command, metric, direction, and evaluator. Use when the user runs /ar:setup or asks to start optimizing a file with the autoresearch loop.
ai
Behuman
Use when the user wants more human-like AI responses — less robotic, less listy, more authentic. Triggers: 'behuman', 'be real', 'like a human', 'more human', 'less AI', 'talk like a person', 'mirror mode', 'stop being so AI', or when conversations are emotionally charged (grief…
ai
Chaos Engineering
Use when planning, running, or learning from chaos engineering experiments. Triggers on "chaos experiment", "fault injection", "gameday", "resilience test", "blast radius", "steady state", "abort criteria", "Chaos Toolkit", "Chaos Mesh", "Litmus", "Gremlin", "AWS FIS", or any de…
pythonawskubernetesai
Code Tour
Use when the user asks to create a CodeTour .tour file — persona-targeted, step-by-step walkthroughs that link to real files and line numbers. Trigger for: create a tour, onboarding tour, architecture tour, PR review tour, explain how X works, vibe check, RCA tour, contributor g…
ai
Collab Proof
Use when you want to understand what Claude contributed vs what you drove in a session. Triggers on: /collab-proof, session retrospective, ai contribution analysis, collaboration evidence, what did claude do.
ai
Data Quality Auditor
Audit datasets for completeness, consistency, accuracy, and validity. Profile data distributions, detect anomalies and outliers, surface structural issues, and produce an actionable remediation plan. Use when the user asks to check data quality, profile a dataset, hunt outliers …
ai
Docker Development
Docker and container development agent skill and plugin for Dockerfile optimization, docker-compose orchestration, multi-stage builds, and container security hardening. Use when: user wants to optimize a Dockerfile, create or improve docker-compose configurations, implement mult…
dockersecurityperformanceai+1
Grill With Docs
Docs-anchored grilling session — challenges a plan against the project's existing language (CONTEXT.md) and recorded decisions (docs/adr/), and updates those files inline as terminology and decisions crystallise. Use when user wants to stress-test a plan against documented domai…
ai
Llm Cost Optimizer
Use proactively whenever LLM API costs come up -- or should. Triggers include: 'my AI costs are too high', 'optimize token usage', 'which model should I use', 'LLM spend is out of control', 'implement prompt caching', 'we're about to launch an AI feature', 'build me an AI endpoi…
apiaillmrag
Llm Wiki
Use when building or maintaining a persistent personal knowledge base (second brain) in Obsidian where an LLM incrementally ingests sources, updates entity/concept pages, maintains cross-references, and keeps a synthesis current. Triggers include "second brain", "Obsidian wiki",…
aillmrag
Prompt Governance
Use when managing prompts in production at scale: versioning prompts, running A/B tests on prompts, building prompt registries, preventing prompt regressions, or creating eval pipelines for production AI features. Triggers: 'manage prompts in production', 'prompt versioning', 'p…
goaillmrag
Agent Designer
Use when the user asks to design a multi-agent system, pick an orchestration pattern (supervisor/swarm/pipeline), generate tool schemas for agents, or evaluate agent execution logs for cost, latency, and failure bottlenecks. Examples: 'design an agent architecture for research a…
automationaiagent
Agent Workflow Designer
Design production-grade multi-agent workflows with clear pattern choice (sequential, parallel, hierarchical), handoff contracts, failure handling, and cost/context controls. Use when architecting a multi-step agent pipeline, choosing between single-agent vs multi-agent approache…
aillmagent
Env Secrets Manager
Manage environment-variable hygiene and secrets safety across local development and production. Practical auditing, drift awareness, rotation readiness. Use when auditing .env files for committed secrets, planning a credential rotation, debugging missing-env-var production incid…
ai
Focused Fix
Use when the user asks to fix, debug, or make a specific feature/module/area work end-to-end. Triggers: 'make X work', 'fix the Y feature', 'the Z module is broken', 'focus on [area]'. Not for quick single-bug fixes — this is for systematic deep-dive repair across all files and …
ai
Full Page Screenshot
Use when the user asks to capture a full-page screenshot, long screenshot, or complete page capture of a web page. Handles SPA scroll containers, lazy-loaded images, and very tall pages via Chrome DevTools Protocol with zero external dependencies.
ai
Rag Architect
Use when the user asks to design a RAG pipeline, choose a chunking strategy or embedding model, pick a vector database, or evaluate retrieval quality (precision@k, recall@k, NDCG). Examples: 'design a RAG system for our docs', 'what chunk size should I use for this corpus', 'eva…
aillmembeddingrag+1
Runbook Generator
Generate operational runbooks from a service name — deployment, incident response, maintenance, and rollback workflows. Templated structure customizable per environment. Use when documenting on-call procedures for a new service, standardizing incident response across teams, or p…
deploymentai
Self Eval
Honestly evaluate AI work quality using a two-axis scoring system. Use after completing a task, code review, or work session to get an unbiased assessment. Detects score inflation, forces devil's advocate reasoning, and persists scores across sessions.
ai
Ship Gate
Pre-production audit that scans a codebase for security, database, deployment, code quality, AI/LLM, dependency, frontend, and observability issues. Intercepts deploy commands and blocks until critical items pass. Stack-agnostic. Use for "run ship gate", "am I ready to ship", "p…
gosecuritydeploymentai+1
Skill Security Auditor
Security audit and vulnerability scanner for AI agent skills before installation. Use when: (1) evaluating a skill from an untrusted source, (2) auditing a skill directory or git repo URL for malicious code, (3) pre-install security gate for Claude Code plugins, OpenClaw skills,…
pythonrustsecurityai+1
Tc Tracker
Use when the user asks to track technical changes, create change records, manage TC lifecycles, or hand off work between AI sessions. Covers init/create/update/status/resume/close/export workflows for structured code change documentation.
ai
Tech Debt Tracker
Scan codebases for technical debt, score severity, track trends, and generate prioritized remediation plans. Use when users mention tech debt, code quality, refactoring priority, debt scoring, cleanup sprints, or code health assessment. Also use for legacy code modernization pla…
ai
Design System
Captures the user's brand identity once via a 10-question onboarding wizard (primary/accent HEX + heading + body Google Fonts + design style editorial/technical/minimal/playful + default output directory + syntax theme + TOC behavior + optional logo/company), validates body-text…
goai
Markdown Html Orchestrator
Use when a user wants to convert any markdown file in their Claude project into a single-file, lightly-interactive HTML — long-form documents (specs, plans, RFCs, reports, explainers), code reviews with diffs and severity-tagged annotations, or slide decks. Triggers on "convert …
ai
Md Document
Converts long-form markdown (specs, RFCs, reports, plans, explainers) into a single-file, lightly-interactive HTML document with sticky TOC, scrollspy, search filter, code-copy buttons, and design-system-driven brand tokens. Triggers when the markdown-html-orchestrator classifie…
goai
Ad Creative
When the user needs to generate, iterate, or scale ad creative for paid advertising. Use when they say 'write ad copy,' 'generate headlines,' 'create ad variations,' 'bulk creative,' 'iterate on ads,' 'ad copy validation,' 'RSA headlines,' 'Meta ad copy,' 'LinkedIn ad,' or 'crea…
testingai
Aeo
Answer Engine Optimization (AEO) skill — optimize content to be cited by AI language models (ChatGPT, Perplexity, Claude, Gemini, Mistral) as authoritative sources. Distinct from SEO — AEO optimizes for citation in LLM-generated responses, not search rankings. Use when planning …
pythonaillm
Analytics Tracking
Set up, audit, and debug analytics tracking implementation — GA4, Google Tag Manager, event taxonomy, conversion tracking, and data quality. Use when building a tracking plan from scratch, auditing existing analytics for gaps or errors, debugging missing events, or setting up GT…
goai
Campaign Analytics
Analyzes campaign performance with multi-touch attribution, funnel conversion analysis, and ROI calculation for marketing optimization. Use when analyzing marketing campaigns, ad performance, attribution models, conversion rates, or calculating marketing ROI, ROAS, CPA, and camp…
performanceai
Churn Prevention
Reduce voluntary and involuntary churn through cancel flow design, save offers, exit surveys, and dunning sequences. Use when designing or optimizing a cancel flow, building save offers, setting up dunning emails, or reducing failed-payment churn. Trigger keywords: cancel flow, …
ai
Cold Email
When the user wants to write, improve, or build a sequence of B2B cold outreach emails to prospects who haven't asked to hear from them. Use when the user mentions 'cold email,' 'cold outreach,' 'prospecting emails,' 'SDR emails,' 'sales emails,' 'first touch email,' 'follow-up …
ai
Content Humanizer
Makes AI-generated content sound genuinely human — not just cleaned up, but alive. Use when content feels robotic, uses too many AI clichés, lacks personality, or reads like it was written by committee. Triggers: 'this sounds like AI', 'make it more human', 'add personality', 'i…
ai
Copywriting
When the user wants to write, rewrite, or improve marketing copy for any page — including homepage, landing pages, pricing pages, feature pages, about pages, or product pages. Also use when the user says \"write copy for,\" \"improve this copy,\" \"rewrite this page,\" \"marketi…
ai
Email Sequence
When the user wants to create or optimize an email sequence, drip campaign, automated email flow, or lifecycle email program. Also use when the user mentions "email sequence," "drip campaign," "nurture sequence," "onboarding emails," "welcome sequence," "re-engagement emails," "…
automationai
Form Cro
When the user wants to optimize any form that is NOT signup/registration — including lead capture forms, contact forms, demo request forms, application forms, survey forms, or checkout forms. Also use when the user mentions "form optimization," "lead form conversions," "form fri…
ai
Launch Strategy
When the user wants to plan a product launch, feature announcement, or release strategy. Also use when the user mentions 'launch,' 'Product Hunt,' 'feature release,' 'announcement,' 'go-to-market,' 'beta launch,' 'early access,' 'waitlist,' 'product update,' 'GTM plan,' 'launch …
goai
Marketing Context
Create and maintain the marketing context document that all marketing skills read before starting. Use when the user mentions 'marketing context,' 'brand voice,' 'set up context,' 'target audience,' 'ICP,' 'style guide,' 'who is my customer,' 'positioning,' or wants to avoid rep…
ai
Marketing Demand Acquisition
Creates demand generation campaigns, optimizes paid ad spend across LinkedIn, Google, and Meta, develops SEO strategies, and structures partnership programs. Use when planning demand gen strategy, growth marketing, advertising campaigns, PPC optimization, lead generation, pipeli…
goai
Marketing Ops
Central router for the marketing skill ecosystem. Use when unsure which marketing skill to use, when orchestrating a multi-skill campaign, or when coordinating across content, SEO, CRO, channels, and analytics. Also use when the user mentions 'marketing help,' 'campaign plan,' '…
ai
Onboarding Cro
When the user wants to optimize post-signup onboarding, user activation, first-run experience, or time-to-value. Also use when the user mentions "onboarding flow," "activation rate," "user activation," "first-run experience," "empty states," "onboarding checklist," "aha moment,"…
goai
Paid Ads
When the user wants help with paid advertising campaigns on Google Ads, Meta (Facebook/Instagram), LinkedIn, Twitter/X, or other ad platforms. Also use when the user mentions 'PPC,' 'paid media,' 'ad copy,' 'ad creative,' 'ROAS,' 'CPA,' 'ad campaign,' 'retargeting,' or 'audience…
goai
Paywall Upgrade Cro
When the user wants to create or optimize in-app paywalls, upgrade screens, upsell modals, or feature gates. Also use when the user mentions "paywall," "upgrade screen," "upgrade modal," "upsell," "feature gate," "convert free to paid," "freemium conversion," "trial expiration s…
ai
Popup Cro
When the user wants to create or optimize popups, modals, overlays, slide-ins, or banners for conversion purposes. Also use when the user mentions "exit intent," "popup conversions," "modal optimization," "lead capture popup," "email popup," "announcement banner," or "overlay." …
ai
Prompt Engineer Toolkit
Turns marketing prompts into tested, versioned production assets: A/B prompt evaluation against structured test cases, immutable prompt version history with diffs, ready-to-use marketing prompt templates (ad copy, email campaigns, social posts, landing pages, SEO meta), and an L…
goaillm
Schema Markup
When the user wants to implement, audit, or validate structured data (schema markup) on their website. Use when the user mentions 'structured data,' 'schema.org,' 'JSON-LD,' 'rich results,' 'rich snippets,' 'schema markup,' 'FAQ schema,' 'Product schema,' 'HowTo schema,' or 'str…
ai
Social Media Analyzer
Social media campaign analysis and performance tracking. Calculates engagement rates, ROI, and benchmarks across platforms. Use when analyzing social media performance, calculating engagement rate, measuring campaign ROI, comparing platform metrics, or benchmarking against indus…
performanceai
Webinar Marketing
When the user wants to plan, promote, run, or improve a webinar or virtual event to generate and convert demand. Use when the user mentions 'webinar,' 'virtual event,' 'online event,' 'live demo,' 'virtual summit,' 'workshop,' 'masterclass,' 'fireside chat,' 'roundtable,' 'regis…
ai
Landing
Generates a premium single-page HTML landing page with 3D CSS animations, GSAP scroll effects, and mouse-parallax depth. Forcing intake (product + elevator pitch, audience register, brand overrides, tone) locks down positioning before any copy or markup is written, so the page r…
ai
Apple Hig Expert
Audits and designs iOS/macOS/watchOS/visionOS interfaces against the Apple Human Interface Guidelines, including the Liquid Glass design language (announced WWDC25, shipped with iOS 26/macOS Tahoe, Sept 2025). Use when reviewing an Apple-platform mockup or app for HIG compliance…
ai
Code To Prd
Reverse-engineer any codebase into a complete Product Requirements Document (PRD). Analyzes routes, components, state management, API integrations, and user interactions to produce business-readable documentation detailed enough for engineers or AI agents to fully reconstruct ev…
goreactvuedjango+3
Competitive Teardown
Analyzes competitor products and companies by synthesizing data from pricing pages, app store reviews, job postings, SEO signals, and social media into structured competitive intelligence. Produces feature comparison matrices scored across 12 dimensions, SWOT analyses, positioni…
ai
Landing Page Generator
Generates high-converting landing pages as complete Next.js/React (TSX) components with Tailwind CSS. Creates hero sections, feature grids, pricing tables, FAQ accordions, testimonial blocks, and CTA sections using proven copy frameworks (PAS, AIDA, BAB). Outputs SEO meta tags, …
reactperformanceai
Roadmap Communicator
Use when preparing roadmap narratives, release notes, changelogs, or stakeholder updates tailored for executives, engineering teams, and customers.
ai
Saas Scaffolder
Generates complete, production-ready SaaS project boilerplate including authentication, database schemas, billing integration, API routes, and a working dashboard using Next.js 14+ App Router, TypeScript, Tailwind CSS, shadcn/ui, Drizzle ORM, and Stripe. Use when the user wants …
typescriptapiai
Spec To Repo
Use when the user says 'build me an app', 'create a project from this spec', 'scaffold a new repo', 'generate a starter', 'turn this idea into code', 'bootstrap a project', 'I have requirements and need a codebase', or provides a natural-language project specification and expect…
rustgoapiai
Ui Design System
UI design system toolkit for Senior UI Designer including design token generation, component documentation, responsive design calculations, and developer handoff tools. Use when creating design systems, generating design tokens, maintaining visual consistency, or facilitating de…
ai
Andreessen
Marc Andreessen-mode decision and productivity skill. A blunt, market-first operator that pressure-tests ideas, ventures, features, and career bets through Andreessen's actual frameworks — market dominates team and product; the only milestone that matters is product/market fit; …
ai
Capture
Captures and organizes chaotic brain dumps into a structured, actionable system with zero information loss. Use this skill whenever the user says 'capture this', 'brain dump', 'let me dump some ideas', 'I've got a bunch of thoughts', 'here's everything on my mind', 'idea dump', …
goai
Inbox Setup
One-time setup skill that builds a personalized inbox triage knowledge base via interactive interview. Interviews the user about their email patterns, business context, reply style, and priorities using grill-me discipline (one question at a time, forcing format where possible, …
ai
Inbox Triage
Runs a full inbox triage using the knowledge base created by the 'inbox-setup' skill. Light-intake by design (most invocations skip questions and run with KB-default preferences); asks at most 2 grill-me override questions when invocation is outside normal cadence or includes ca…
goai
Reflect
Mid-conversation reflection skill that pauses execution and zooms out from detail-mode to honestly reassess direction, assumptions, and bias. Use when the user says 'reflect', 'take a step back', 'step back', 'zoom out', 'are we missing something', 'bigger picture', 'sanity chec…
gorestai
Eu Ai Act Specialist
EU AI Act (Regulation (EU) 2024/1689) operational compliance for compliance teams. Three Article-level decisions: (1) What's the risk tier of this AI system — prohibited (Art. 5), high-risk (Art. 6 + Annex III), limited-risk (Art. 50), or minimal-risk? (2) For high-risk systems,…
goai
Iso42001 Specialist
ISO/IEC 42001:2023 AI Management System (AIMS) specialist for compliance teams running internal audits. Three decisions: (1) Where are the gaps against Clauses 4-10 and what do we close first? (2) What goes in the AI risk register and which Annex A controls treat each risk? (3) …
goai
Quality Manager Qms Iso13485
ISO 13485 Quality Management System implementation and maintenance for medical device organizations. Provides QMS design, documentation control, internal auditing, CAPA management, and certification support. Use when working with medical device quality systems, preparing for ISO…
ai
Ra Qm Skills
Router/index for the 15 regulatory & quality-management skills bundled in this plugin (ISO 13485 QMS, EU MDR 2017/745, FDA submissions under QMSR, ISO 14971 risk, CAPA, document control, ISO 27001/ISMS, ISO 42001 AIMS, EU AI Act, GDPR/DSGVO, SOC 2, auditing). Use when a complian…
ai
Regulatory Affairs Head
Senior Regulatory Affairs Manager for HealthTech and MedTech companies. Prepares FDA 510(k), De Novo, and PMA submission packages; analyzes regulatory pathways for new medical devices; drafts responses to FDA deficiency letters and Notified Body queries; develops CE marking tech…
ai
Market Research
Use when doing upstream market-research methodology — sizing a market as TAM/SAM/SOM computed BOTH top-down and bottoms-up (never a single unsourced number), planning a survey sample size with finite-population correction and per-segment minimums, or scoring candidate market seg…
ai
Research Finance
Use when managing the money for an internal R&D program or portfolio — building a multi-period program budget with the F&A (indirect) split, tracking burn rate and runway against value-inflection milestones, or routing R&D cost items to a capitalize-vs-expense determination. Eve…
apiai
Research Ops Skills
Use when planning, funding, scoping, or synthesizing enterprise research across workstreams — clinical study design, R&D program finance, market sizing/surveys, or product/user research. Triggers on "design this clinical study", "what sample size", "R&D budget", "burn rate", "ca…
apiai
Litreview
Academic literature orientation skill that searches papers via Consensus, builds a strategic search plan using PICO (default) or SPIDER / Decomposition / hybrid as fallbacks, and synthesizes findings into a formatted Word (.docx) research guide. Grill-me intake (research questio…
airag
Notebooklm
Browser automation skill for controlling Google's NotebookLM. Use when the user wants anything done in NotebookLM (e.g., 'open NotebookLM', 'check my [name] notebook', 'ask my notebook about X', 'add [source] to NotebookLM', 'generate a Video Overview from my notebook', 'use Not…
gobrowserautomationai
Patent
Patent prior-art and landscape intelligence skill — not generic patent help. Commits to one of five sub-use-cases via forcing intake (novelty search / freedom-to-operate / competitive landscape / acquisition diligence / litigation prior-art) before any search runs. Searches Goog…
goairag
Syllabus
Generates a curated supplementary reading list from any course syllabus using Consensus academic search. Grill-me intake (syllabus input format + course audience + year range) plus a grouping forcing-options checkpoint before any search runs — so the reading list matches the cou…
goai
Intended Vs Implemented
The method for finding the gap between what a system is supposed to do and what the code actually does — the class of bug generic scanners miss because they have no model of intent. Defines what counts as documented intent, what counts as implementation evidence, which mismatche…
ai
Shipping Artifacts
The durable documentation set that makes an AI-built (vibe-coded) app reviewable before shipping. A small core every app needs — architecture, user/permission flows, permissions, variables/secrets, and a test-coverage map — plus conditional docs added only when they apply: email…
rustsecurityperformanceautomation+3
Brainstorm Okrs
Brainstorm team-level OKRs aligned with company objectives — qualitative objectives with measurable key results. Use when setting quarterly OKRs, aligning team goals with company strategy, drafting objectives, or learning how to write effective OKRs.
goai
Dummy Dataset
Generate realistic dummy datasets for testing with customizable columns, constraints, and output formats (CSV, JSON, SQL, Python script). Use when creating test data, building mock datasets, or generating sample data for development and demos.
pythontestingai
Job Stories
Create job stories using the 'When [situation], I want to [motivation], so I can [outcome]' format with detailed acceptance criteria. Use when writing job stories, creating JTBD-style backlog items, or expressing user situations and motivations.
ai
Sprint Plan
Plan a sprint with capacity estimation, story selection, dependency mapping, and risk identification. Use when preparing for sprint planning, estimating team capacity, selecting stories, or balancing sprint scope against velocity.
ai
Strategy Red Team
Red-team a PRD, roadmap, or strategy by attacking its load-bearing assumptions before reality does. Steelmans then attacks each claim, ranks failure modes by impact × likelihood × cheapness-to-test, and returns the cheapest test and kill criteria for each. Use when stress-testin…
testingai
Beachhead Segment
Identify the first beachhead market segment for a product launch. Evaluates segments against burning pain, willingness to pay, winnable market share, and referral potential. Use when choosing a first market, targeting an initial customer segment, or planning market entry strateg…
ai
Competitive Battlecard
Create sales-ready competitive battlecards comparing your product against a specific competitor — positioning, feature comparison, objection handling, and win/loss patterns. Use when preparing sales teams, creating competitive materials, or responding to 'why not competitor X?'
ai
Growth Loops
Identify growth loops (flywheels) for sustainable traction. Evaluates 5 loop types: Viral, Usage, Collaboration, User-Generated, and Referral. Use when designing growth mechanisms, building product-led traction, or understanding how growth loops work.
ai
Gtm Motions
Identify the best GTM motions and tools across 7 motion types: Inbound, Outbound, Paid Digital, Community, Partners, ABM, and PLG. Use when selecting marketing channels, choosing between inbound and outbound strategy, or planning cross-channel campaigns.
ai
Customer Journey Map
Create an end-to-end customer journey map with stages, touchpoints, emotions, pain points, and opportunities. Use when mapping the customer experience, identifying friction points, improving onboarding, or visualizing the user journey.
ai
User Personas
Create refined user personas from research data — 3 personas with JTBD, pains, gains, and unexpected insights. Use when building personas from survey data, creating user profiles from research, or segmenting users for product decisions.
ai
Marketing Ideas
Generate 5 creative, cost-effective marketing ideas with channels, messaging, and engagement rationale. Use when brainstorming marketing campaigns, planning product promotion, or looking for creative marketing tactics.
ai
North Star Metric
Define a North Star Metric and 3-5 supporting input metrics that form a metrics constellation. Classify the business game (Attention, Transaction, Productivity) and validate against 7 criteria for an effective North Star. Use when choosing a North Star Metric, setting up a metri…
ai
Positioning Ideas
Brainstorm product positioning ideas differentiated from competitors. Identifies top competitors and generates positioning statements with rationale. Use when developing product positioning, differentiating from competitors, or crafting brand positioning strategy.
ai
Product Name
Brainstorm 5 unique, memorable product names with rationale aligned to brand values and target audience. Use when naming a new product, rebranding, or exploring product name ideas.
ai
Brainstorm Experiments Existing
Design experiments to test assumptions for an existing product — prototypes, A/B tests, spikes, and other low-effort validation methods. Use when validating assumptions, testing feature ideas cheaply, or planning product experiments.
testingai
Brainstorm Experiments New
Design lean startup experiments (pretotypes) for a new product. Creates XYZ hypotheses and suggests low-effort validation methods like landing pages, explainer videos, and pre-orders. Use when validating a new product idea, creating pretotypes, or testing market demand.
testingai
Brainstorm Ideas Existing
Brainstorm product ideas for an existing product using multi-perspective ideation from PM, Designer, and Engineer viewpoints. Use when generating new feature ideas, brainstorming solutions for an identified opportunity, or ideating with a product trio.
ai
Brainstorm Ideas New
Brainstorm feature ideas for a new product in initial discovery from PM, Designer, and Engineer perspectives. Use when starting product discovery for a new product, exploring features for a startup idea, or doing initial ideation.
ai
Lean Canvas
Generate a Lean Canvas with problem, solution, metrics, cost structure, UVP, unfair advantage, channels, segments, and revenue. Use when exploring a lean startup canvas, testing a business hypothesis, or modeling a new venture.
testingai
Monetization Strategy
Brainstorm 3-5 monetization strategies with audience fit, risks, and validation experiments. Use when exploring revenue models, evaluating pricing strategies, or deciding how to monetize a product.
ai
Pricing Strategy
Analyze and design pricing strategies including pricing models, competitive pricing analysis, willingness-to-pay estimation, and price elasticity. Use when setting prices, evaluating pricing models, preparing for a pricing change, or comparing freemium vs paid approaches.
ai
Product Vision
Brainstorm an inspiring, achievable, and emotional product vision that motivates teams and aligns stakeholders. Use when defining or refining a product vision, creating a vision statement, or aligning the team around a shared direction.
ai
Swot Analysis
Perform a detailed SWOT analysis — strengths, weaknesses, opportunities, and threats with actionable recommendations. Use when doing strategic assessment, competitive analysis, or evaluating a product or business position.
ai
Value Proposition
Design a detailed value proposition using a 6-part JTBD template — Who, Why, What before, How, What after, Alternatives. Use when creating a value proposition, analyzing customer value delivery, or articulating why customers should choose your product.
ai
Draft Nda
Draft a detailed Non-Disclosure Agreement between two parties covering information types, jurisdiction, and clauses needing legal review. Use when creating confidentiality agreements or preparing an NDA for a partnership.
ai
Privacy Policy
Draft a detailed privacy policy covering data types, jurisdiction, GDPR and compliance considerations, and clauses needing legal review. Use when creating a privacy policy, updating data protection documentation, or preparing for compliance.
ai
Review Resume
Comprehensive PM resume review and tailoring against 10 best practices including XYZ+S formula, keyword optimization, job-specific tailoring, and structure. Use when reviewing a PM resume, preparing for job applications, or improving resume impact.
ai
Access Control Rbac
Role-based access control (RBAC) with permissions and policies. Use for admin dashboards, enterprise access, multi-tenant apps, fine-grained authorization, or encountering permission hierarchies, role inheritance, policy conflicts.
ai
Aceternity Ui
100+ animated React components (Aceternity UI) for Next.js with Tailwind. Use for hero sections, parallax, 3D effects, or encountering animation, shadcn CLI integration errors.
reactai
Ai Elements Chatbot
shadcn/ui AI chat components for conversational interfaces. Use for streaming chat, tool/function displays, reasoning visualization, or encountering Next.js App Router setup, Tailwind v4 integration, AI SDK v5 migration errors.
ai
Ai Sdk Core
Vercel AI SDK v5 for backend AI (text generation, structured output, tools, agents). Multi-provider. Use for server-side AI or encountering AI_APICallError, AI_NoObjectGeneratedError, streaming failures.
vercelapiaiagent
Ai Sdk Ui
Vercel AI SDK v5 React hooks (useChat, useCompletion, useObject) for AI chat interfaces. Use for React/Next.js AI apps or encountering parse stream errors, no response, streaming issues.
reactvercelai
Api Design Principles
Master REST and GraphQL API design principles to build intuitive, scalable, and maintainable APIs that delight developers. Use when designing new APIs, reviewing API specifications, or establishing API design standards.
apigraphqlrestai
Api Rate Limiting
Implements API rate limiting using token bucket, sliding window, and Redis-based algorithms to protect against abuse. Use when securing public APIs, implementing tiered access, or preventing denial-of-service attacks.
goredisapiai
Architecture Patterns
Implement proven backend architecture patterns including Clean Architecture, Hexagonal Architecture, and Domain-Driven Design. Use when architecting complex backend systems or refactoring existing applications for better maintainability.
goai
Better Chatbot Patterns
Reusable better-chatbot patterns for custom deployments. Use for server action validators, tool abstraction, multi-AI providers, or encountering auth validation, FormData parsing, workflow execution errors.
deploymentai
Bun Docker
Use for Docker with Bun, Dockerfiles, oven/bun image, containerization, and deployments.
dockerdeploymentai
Claude Code Bash Patterns
Claude Code Bash tool patterns with hooks, automation, git workflows. Use for PreToolUse hooks, command chaining, CLI orchestration, custom commands, or encountering bash permissions, command failures, security guards, hook configurations.
securityautomationai
Cloudflare Agents
Build AI agents on Cloudflare Workers with MCP integration, tool use, and LLM providers.
cloudflareaillmagent
Cloudflare Email Routing
Cloudflare Email Routing for receiving/sending emails via Workers. Use for email workers, forwarding, allowlists, or encountering Email Trigger errors, worker call failures, SPF issues.
cloudflareai
Cloudflare Manager
Comprehensive Cloudflare account management for deploying Workers, KV Storage, R2, Pages, DNS, and Routes. Use when deploying cloudflare services, managing worker containers, configuring KV/R2 storage, or setting up DNS/routing. Requires CLOUDFLARE_API_KEY in .env and Bun runtim…
cloudflareapiairag
Cloudflare R2
Cloudflare R2 S3-compatible object storage. Use for buckets, uploads, CORS, presigned URLs, or encountering R2_ERROR, CORS failures, multipart issues.
cloudflareairag
Cloudflare Sandbox
Cloudflare Sandboxes SDK for secure code execution in Linux containers at edge. Use for untrusted code, Python/Node.js scripts, AI code interpreters, git operations.
pythonrustnodecloudflare+1
Cloudflare Turnstile
This skill should be used when the user asks to \"add turnstile\", \"implement bot protection\", \"validate turnstile token\", \"fix turnstile error\", \"setup captcha alternative\", or encounters error codes 100*/300*/600*, CSP errors, or token validation failures. Provides CAP…
reactcloudflareai
Cloudflare Workers Ai
Cloudflare Workers AI for serverless GPU inference. Use for LLMs, text/image generation, embeddings, or encountering AI_ERROR, rate limits, token exceeded errors.
cloudflareaillmembedding
Cloudflare Workers Ci Cd
Complete CI/CD guide for Cloudflare Workers using GitHub Actions and GitLab CI. Use for automated testing, deployment pipelines, preview environments, secrets management, or encountering deployment failures, workflow errors, environment configuration issues.
cloudflaregithubgitlabtesting+2
Cloudflare Workers Observability
Cloudflare Workers observability with logging, Analytics Engine, Tail Workers, metrics, and alerting. Use for monitoring, debugging, tracing, or encountering log parsing, metric aggregation, alert configuration errors.
cloudflaremonitoringai
Cloudflare Workers Security
Cloudflare Workers security with authentication, CORS, rate limiting, input validation. Use for securing APIs, JWT/API keys, or encountering auth failures, CORS errors, XSS/injection vulnerabilities.
cloudflaresecurityapiai
Cloudflare Workers Testing
Comprehensive testing guide for Cloudflare Workers using Vitest and @cloudflare/vitest-pool-workers. Use for test setup, binding mocks (D1/KV/R2/DO), integration tests, or encountering test failures, mock errors, coverage issues.
cloudflaretestingairag
Cloudflare Workflows
Cloudflare Workflows for durable long-running execution. Use for multi-step workflows, retries, state persistence, or encountering NonRetryableError, execution failed errors.
cloudflareai
Code Review
Code review practices with technical rigor and verification gates. Use for receiving feedback, requesting code-reviewer subagent reviews, or preventing false completion claims in pull requests.
goaiagent
Database Schema Design
Database schema design for PostgreSQL/MySQL with normalization, relationships, constraints. Use for new databases, schema reviews, migrations, or encountering missing PKs/FKs, wrong data types, premature denormalization, EAV anti-pattern.
postgresmysqlai
Defense In Depth Validation
Validate at every layer data passes through to make bugs impossible. Use when invalid data causes failures deep in execution, requiring validation at multiple system layers.
ai
Dependency Upgrade
Secure dependency upgrades with supply chain protection, cooldowns, and staged rollout. Use when upgrading deps, configuring security policies, or preventing supply chain attacks.
securityai
Drizzle Orm D1
| Type-safe ORM for Cloudflare D1 databases using Drizzle. Use when: building D1 database schemas, writing type-safe SQL queries, managing migrations with Drizzle Kit, defining table relations, implementing prepared statements, using D1 batch API, or encountering D1_ERROR, trans…
cloudflareapiai
Elevenlabs Agents
ElevenLabs Agents Platform for AI voice agents (React/JS/Native/Swift). Use for voice AI, RAG, tools, or encountering package deprecation, audio cutoff, CSP violations, webhook auth failures.
swiftreactairag+1
Frontend Design
Create distinctive, production-grade frontend interfaces with high design quality. Use this skill when the user asks to build web components, pages, or applications. Generates creative, polished code that avoids generic AI aesthetics.
ai
Google Gemini Api
Google Gemini API with @google/genai SDK. Use for multimodal AI, thinking mode, function calling, or encountering SDK deprecation warnings, context errors, multimodal format errors.
goapiai
Google Gemini File Search
Google Gemini File Search for managed RAG with 100+ file formats. Use for document Q&A, knowledge bases, or encountering immutability errors, quota issues, polling failures. Supports Gemini 3 Pro/Flash (Gemini 2.5 legacy).
goairag
Health Check Endpoints
Health check endpoints for liveness, readiness, dependency monitoring. Use for Kubernetes, load balancers, auto-scaling, or encountering probe failures, startup delays, dependency checks, timeout configuration errors.
kubernetesmonitoringai
Hugo
Hugo static site generator with Tailwind v4, headless CMS (Sveltia/Tina), Cloudflare deployment. Use for blogs, docs sites, or encountering theme installation, frontmatter, baseURL errors.
gocloudflaredeploymentai
Idempotency Handling
Idempotent API operations with idempotency keys, Redis caching, DB constraints. Use for payment systems, webhook retries, safe retries, or encountering duplicate processing, race conditions, key expiry errors.
redisapiai
Inspira Ui
120+ Vue/Nuxt animated components with TailwindCSS v4, motion-v, GSAP, Three.js. Use for hero sections, 3D effects, interactive backgrounds, or encountering setup, CSS variables, motion-v integration errors.
vueai
Ml Model Training
Train ML models with scikit-learn, PyTorch, TensorFlow. Use for classification/regression, neural networks, hyperparameter tuning, or encountering overfitting, underfitting, convergence issues.
ai
Ml Pipeline Automation
Automate ML workflows with Airflow, Kubeflow, MLflow. Use for reproducible pipelines, retraining schedules, MLOps, or encountering task failures, dependency errors, experiment tracking issues.
automationai
Model Deployment
Deploy ML models with FastAPI, Docker, Kubernetes. Use for serving predictions, containerization, monitoring, drift detection, or encountering latency issues, health check failures, version conflicts.
kubernetesdockerdeploymentmonitoring+2
Multi Ai Consultant
Consult external AIs (Gemini 2.5 Pro, OpenAI Codex, Claude) for second opinions. Use for debugging failures, architectural decisions, security validation, or need fresh perspective with synthesis.
securityai
Nuxt Studio
This skill should be used when the user asks to "set up Nuxt Studio", "configure Studio OAuth", "deploy Studio to Cloudflare", "add visual editor to Nuxt", "configure studio.domain.com subdomain", "Studio authentication", "Nuxt CMS", or mentions visual content editing, Nuxt Stud…
cloudflareai
Nuxt Ui V4
Nuxt UI v4 component library for building Nuxt v4 applications. 125+ accessible components with Tailwind v4, Reka UI, dark mode, theming. Use for dashboards, forms, overlays, editors, page layouts, pricing pages, or encountering component, theming, or TypeScript errors.
typescriptai
Openai Agents
OpenAI Agents SDK for JavaScript/TypeScript (text + voice agents). Use for multi-agent workflows, tools, guardrails, or encountering Zod errors, MCP failures, infinite loops, tool call issues.
typescriptjavascriptaiagent
Openai Api
Complete guide for OpenAI APIs: Chat Completions (GPT-5.2, GPT-4o), Embeddings, Images (GPT-Image-1.5), Audio (Whisper + TTS + Transcribe), Moderation. Includes Node.js SDK and fetch approaches.
nodeapiaiembedding
Openai Assistants
OpenAI Assistants API v2 for stateful chatbots with Code Interpreter, File Search, RAG. Use for threads, vector stores, or encountering active run errors, indexing delays. ⚠️ Sunset August 26, 2026.
apiairag
Openai Responses
OpenAI Responses API for stateful agentic applications with reasoning preservation. Use for MCP integration, built-in tools, background processing, or migrating from Chat Completions.
apiaiagent
Security Headers Configuration
Configures HTTP security headers to protect against XSS, clickjacking, and MIME sniffing attacks. Use when hardening web applications, passing security audits, or implementing Content Security Policy.
securityai
Shadcn Vue
shadcn-vue for Vue/Nuxt with Reka UI components and Tailwind. Use for accessible UI, Auto Form, data tables, charts, or encountering component imports, dark mode, Reka UI errors.
vueai
Sql Query Optimization
SQL query optimization for PostgreSQL/MySQL with indexing, EXPLAIN analysis. Use for slow queries, N+1 problems, missing indexes, or encountering sequential scans, OFFSET pagination, temp table spills, inefficient JOINs.
postgresmysqlai
Swift Best Practices
| This skill should be used when writing or reviewing Swift code for iOS or macOS projects. Apply modern Swift 6+ best practices, concurrency patterns, API design guidelines, and migration strategies. Covers async/await, actors, MainActor, Sendable, typed throws, and Swift 6 bre…
swiftapiai
Systematic Debugging
Four-phase debugging framework that ensures root cause investigation before attempting fixes. Never jump to solutions. Use when encountering any bug, test failure, or unexpected behavior, before proposing fixes.
ai
Tailwind V4 Shadcn
| Production-tested setup for Tailwind CSS v4 with shadcn/ui, Vite, and React. Use when: initializing React projects with Tailwind v4, setting up shadcn/ui, implementing dark mode, debugging CSS variable issues, fixing theme switching, migrating from Tailwind v3, or encountering…
goreactai
Tanstack Ai
TanStack AI (alpha) provider-agnostic type-safe chat with streaming for OpenAI, Anthropic, Gemini, Ollama. Use for chat APIs, React/Solid frontends with useChat/ChatClient, isomorphic tools, tool approval flows, agent loops, multimodal inputs, or troubleshooting streaming and to…
reactapiaiagent
Technical Specification
Creates detailed technical specifications for software projects covering requirements, architecture, APIs, and testing strategies. Use when planning features, documenting system design, or creating architecture decision records.
testingapiai
Test Quality Analysis
Detect test smells, overmocking, flaky tests, and coverage issues. Analyze test effectiveness, maintainability, and reliability. Use when reviewing tests or improving test quality.
airag
Ultracite
Ultracite multi-provider linting/formatting (Biome, ESLint, Oxlint). Use for v6/v7 setup, provider selection, Git hooks, MCP integration, AI hooks, migrations, or encountering configuration, type-aware linting, monorepo errors.
ai
Verification Before Completion
Run verification commands and confirm output before claiming success. Use when about to claim work is complete, fixed, or passing, before committing or creating PRs.
ai
Vulnerability Scanning
Automated security scanning for dependencies, code, containers with Trivy, Snyk, npm audit. Use for CI/CD security gates, pre-deployment audits, compliance requirements, or encountering CVE detection, outdated packages, license compliance, SBOM generation errors.
securitydeploymentai
Brainstorming
You MUST use this before any creative work - creating features, building components, adding functionality, or modifying behavior. Explores user intent, requirements and design before implementation.
ai
Systematic Debugging
Use when encountering any bug, test failure, or unexpected behavior, before proposing fixes
ai
Verification Before Completion
Use when about to claim work is complete, fixed, or passing, before committing or creating PRs - requires running verification commands and confirming output before making any success claims; evidence before assertions always
ai
Container Security Auditor
Audit container security auditor operations. Auto-activating skill for Security Advanced. Triggers on: container security auditor, container security auditor Part of the Security Advanced skill category. Use when analyzing or auditing container security auditor. Trigger with phr…
gosecurityai
Tailwind Class Optimizer
Optimize tailwind class optimizer operations. Auto-activating skill for Frontend Development. Triggers on: tailwind class optimizer, tailwind class optimizer Part of the Frontend Development skill category. Use when working with tailwind class optimizer functionality. Trigger wi…
goai
Confusion Matrix Generator
Generate confusion matrix generator operations. Auto-activating skill for ML Training. Triggers on: confusion matrix generator, confusion matrix generator Part of the ML Training skill category. Use when working with confusion matrix generator functionality. Trigger with phrases…
goai
Cross Validation Setup
Configure cross validation setup operations. Auto-activating skill for ML Training. Triggers on: cross validation setup, cross validation setup Part of the ML Training skill category. Use when working with cross validation setup functionality. Trigger with phrases like "cross va…
goai
Data Augmentation Pipeline
Process data augmentation pipeline operations. Auto-activating skill for ML Training. Triggers on: data augmentation pipeline, data augmentation pipeline Part of the ML Training skill category. Use when working with data augmentation pipeline functionality. Trigger with phrases …
goai
Dataset Loader Creator
Create dataset loader creator operations. Auto-activating skill for ML Training. Triggers on: dataset loader creator, dataset loader creator Part of the ML Training skill category. Use when working with dataset loader creator functionality. Trigger with phrases like "dataset loa…
goai
Distributed Training Setup
Configure distributed training setup operations. Auto-activating skill for ML Training. Triggers on: distributed training setup, distributed training setup Part of the ML Training skill category. Use when working with distributed training setup functionality. Trigger with phrase…
goai
Early Stopping Callback
Manage early stopping callback operations. Auto-activating skill for ML Training. Triggers on: early stopping callback, early stopping callback Part of the ML Training skill category. Use when working with early stopping callback functionality. Trigger with phrases like "early s…
goai
Feature Engineering Helper
Configure with feature engineering helper operations. Auto-activating skill for ML Training. Triggers on: feature engineering helper, feature engineering helper Part of the ML Training skill category. Use when working with feature engineering helper functionality. Trigger with p…
goai
Feature Importance Analyzer
Analyze feature importance analyzer operations. Auto-activating skill for ML Training. Triggers on: feature importance analyzer, feature importance analyzer Part of the ML Training skill category. Use when analyzing or auditing feature importance analyzer. Trigger with phrases l…
goai
Gradient Clipping Helper
Configure with gradient clipping helper operations. Auto-activating skill for ML Training. Triggers on: gradient clipping helper, gradient clipping helper Part of the ML Training skill category. Use when working with gradient clipping helper functionality. Trigger with phrases l…
goai
Hyperparameter Tuner
Manage hyperparameter tuner operations. Auto-activating skill for ML Training. Triggers on: hyperparameter tuner, hyperparameter tuner Part of the ML Training skill category. Use when working with hyperparameter tuner functionality. Trigger with phrases like "hyperparameter tune…
goai
Learning Rate Scheduler
Manage learning rate scheduler operations. Auto-activating skill for ML Training. Triggers on: learning rate scheduler, learning rate scheduler Part of the ML Training skill category. Use when working with learning rate scheduler functionality. Trigger with phrases like "learnin…
goai
Mixed Precision Trainer
Manage mixed precision trainer operations. Auto-activating skill for ML Training. Triggers on: mixed precision trainer, mixed precision trainer Part of the ML Training skill category. Use when working with mixed precision trainer functionality. Trigger with phrases like "mixed p…
goai
Mlflow Tracking Setup
Configure mlflow tracking setup operations. Auto-activating skill for ML Training. Triggers on: mlflow tracking setup, mlflow tracking setup Part of the ML Training skill category. Use when working with mlflow tracking setup functionality. Trigger with phrases like "mlflow track…
goai
Model Checkpoint Manager
Manage model checkpoint manager operations. Auto-activating skill for ML Training. Triggers on: model checkpoint manager, model checkpoint manager Part of the ML Training skill category. Use when working with model checkpoint manager functionality. Trigger with phrases like "mod…
goai
Model Evaluation Metrics
Build model evaluation metrics operations. Auto-activating skill for ML Training. Triggers on: model evaluation metrics, model evaluation metrics Part of the ML Training skill category. Use when working with model evaluation metrics functionality. Trigger with phrases like "mode…
goai
Model Explainability Tool
Build model explainability tool operations. Auto-activating skill for ML Training. Triggers on: model explainability tool, model explainability tool Part of the ML Training skill category. Use when working with model explainability tool functionality. Trigger with phrases like "…
goai
Optuna Study Creator
Create optuna study creator operations. Auto-activating skill for ML Training. Triggers on: optuna study creator, optuna study creator Part of the ML Training skill category. Use when working with optuna study creator functionality. Trigger with phrases like "optuna study creato…
goai
Pytorch Model Trainer
Build pytorch model trainer operations. Auto-activating skill for ML Training. Triggers on: pytorch model trainer, pytorch model trainer Part of the ML Training skill category. Use when working with pytorch model trainer functionality. Trigger with phrases like "pytorch model tr…
goai
Roc Curve Plotter
Manage roc curve plotter operations. Auto-activating skill for ML Training. Triggers on: roc curve plotter, roc curve plotter Part of the ML Training skill category. Use when working with roc curve plotter functionality. Trigger with phrases like "roc curve plotter", "roc plotte…
goai
Sklearn Pipeline Builder
Build sklearn pipeline builder operations. Auto-activating skill for ML Training. Triggers on: sklearn pipeline builder, sklearn pipeline builder Part of the ML Training skill category. Use when working with sklearn pipeline builder functionality. Trigger with phrases like "skle…
goai
Tensorboard Visualizer
Generate tensorboard visualizer operations. Auto-activating skill for ML Training. Triggers on: tensorboard visualizer, tensorboard visualizer Part of the ML Training skill category. Use when working with tensorboard visualizer functionality. Trigger with phrases like "tensorboa…
goai
Tensorflow Model Trainer
Build tensorflow model trainer operations. Auto-activating skill for ML Training. Triggers on: tensorflow model trainer, tensorflow model trainer Part of the ML Training skill category. Use when working with tensorflow model trainer functionality. Trigger with phrases like "tens…
goai
Train Test Splitter
Test train test splitter operations. Auto-activating skill for ML Training. Triggers on: train test splitter, train test splitter Part of the ML Training skill category. Use when writing or running tests. Trigger with phrases like "train test splitter", "train splitter", "train".
goai
Wandb Experiment Logger
Execute wandb experiment logger operations. Auto-activating skill for ML Training. Triggers on: wandb experiment logger, wandb experiment logger Part of the ML Training skill category. Use when working with wandb experiment logger functionality. Trigger with phrases like "wandb …
goai
Vertex Ai Deployer
Deploy vertex ai deployer operations. Auto-activating skill for ML Deployment. Triggers on: vertex ai deployer, vertex ai deployer Part of the ML Deployment skill category. Use when deploying applications or services. Trigger with phrases like "vertex ai deployer", "vertex deplo…
godeploymentai
Airflow Dag Generator
Generate airflow dag generator operations. Auto-activating skill for Data Pipelines. Triggers on: airflow dag generator, airflow dag generator Part of the Data Pipelines skill category. Use when working with airflow dag generator functionality. Trigger with phrases like "airflow…
goai
Airflow Operator Creator
Create airflow operator creator operations. Auto-activating skill for Data Pipelines. Triggers on: airflow operator creator, airflow operator creator Part of the Data Pipelines skill category. Use when working with airflow operator creator functionality. Trigger with phrases lik…
goai
Vertex Ai Endpoint Config
Configure vertex ai endpoint config operations. Auto-activating skill for GCP Skills. Triggers on: vertex ai endpoint config, vertex ai endpoint config Part of the GCP Skills skill category. Use when configuring systems or services. Trigger with phrases like "vertex ai endpoint …
gogcpai
Vertex Ai Pipeline Creator
Create vertex ai pipeline creator operations. Auto-activating skill for GCP Skills. Triggers on: vertex ai pipeline creator, vertex ai pipeline creator Part of the GCP Skills skill category. Use when working with vertex ai pipeline creator functionality. Trigger with phrases lik…
gogcpai
Mermaid Class Diagram Generator
Generate mermaid class diagram generator operations. Auto-activating skill for Visual Content. Triggers on: mermaid class diagram generator, mermaid class diagram generator Part of the Visual Content skill category. Use when working with mermaid class diagram generator functiona…
goai
Mermaid Er Diagram Creator
Create mermaid er diagram creator operations. Auto-activating skill for Visual Content. Triggers on: mermaid er diagram creator, mermaid er diagram creator Part of the Visual Content skill category. Use when working with mermaid er diagram creator functionality. Trigger with phr…
goai
Mermaid Flowchart Generator
Generate mermaid flowchart generator operations. Auto-activating skill for Visual Content. Triggers on: mermaid flowchart generator, mermaid flowchart generator Part of the Visual Content skill category. Use when working with mermaid flowchart generator functionality. Trigger wi…
goai
Mermaid Gantt Chart Generator
Generate mermaid gantt chart generator operations. Auto-activating skill for Visual Content. Triggers on: mermaid gantt chart generator, mermaid gantt chart generator Part of the Visual Content skill category. Use when working with mermaid gantt chart generator functionality. Tr…
goai
Mermaid Sequence Diagram Creator
Create mermaid sequence diagram creator operations. Auto-activating skill for Visual Content. Triggers on: mermaid sequence diagram creator, mermaid sequence diagram creator Part of the Visual Content skill category. Use when working with mermaid sequence diagram creator functio…
goai
Mermaid State Diagram Creator
Create mermaid state diagram creator operations. Auto-activating skill for Visual Content. Triggers on: mermaid state diagram creator, mermaid state diagram creator Part of the Visual Content skill category. Use when working with mermaid state diagram creator functionality. Trig…
goai
Email Parser
Configure and manage - Parse email parser operations. Auto-activating skill for Business Automation. Triggers on: email parser, email parser Part of the Business Automation skill category. Use when working with email parser functionality. Trigger with phrases like "email parser"…
goautomationai
Audit Trail Helper
Audit Trail Helper - Auto-activating skill for Enterprise Workflows. Triggers on: audit trail helper, audit trail helper Part of the Enterprise Workflows skill category. Use when analyzing or auditing audit trail helper. Trigger with phrases like "audit trail helper", "audit hel…
goai
A11y
Accessibility audit + auto-fix (WCAG 2.2 A/AA). Scans built/static HTML for screen-reader, keyboard, and structure failures, fixes the deterministic ones, and escalates to a rendered scan for contrast and focus. Use when the user wants to check or improve accessibility, fix WCAG…
ai
Architecture
Living Architecture Map — auto-generate Mermaid diagrams of your codebase. Use when user wants to visualize architecture, understand code structure, generate diagrams, or document system design.
ai
Brainstorming
You MUST use this before any creative work - creating features, building components, adding functionality, or modifying behavior. Explores user intent, requirements and design before implementation.
ai
Code Review
Code review with principal-engineer-level depth. Reviews for correctness, performance, security, maintainability, and architecture. Use when completing tasks, reviewing PRs, or before merging.
securityperformanceai
Compete
Competitive X-Ray — analyze any competitor URL vs your site. Use when user wants to compare their site against a competitor, benchmark performance, or understand competitive positioning.
performanceai
Cost
AI Build Cost Tracker — track how much AI is costing you per feature. Use when user wants to track AI spending, understand cost per feature, optimize AI usage, or budget their Claude/GPT costs.
ai
Evals
Build a regression + eval harness for AI-written code and AI features. Generates characterization tests that lock current behavior before a refactor, scaffolds a Promptfoo eval suite for chatbots/RAG/classifiers, and wires it into the ship-gate. Use when the user wants evals, re…
aillmrag
Guard
Safety guardrails — blocks destructive commands (rm -rf, DROP TABLE, force-push, git reset --hard) and optionally restricts file edits to a specific directory. Use when working on critical systems or when you want extra protection.
restai
Seo Audit
Run SEO audit (39 rules) with AI visibility checks — GEO (20 rules for AI bot access, snippet restrictions) and AEO (4 schema checks). Auto-fix included. Use when user wants to check or improve search visibility.
restai
Seo Strategy
Top 1% SEO strategist — ruthlessly analyzes GSC, Bing, and GA4 data to dominate search rankings, win AI citations, and build lead funnels. Every recommendation backed by data.
ai
Ship Gate
Turn the /ship scorecard into a blocking, config-as-code quality gate. Sets per-category score thresholds, hard-fails on leaked secrets or critical findings, and wires the gate into a pre-push hook and CI so nothing below the bar merges. Use when the user wants a merge gate, CI …
goai
Sprint
Sprint workflow pipeline — chains plan → build → test → review → ship skills into a structured sprint. Use when starting a new feature or project iteration to follow the full lifecycle.
ai
Staying Current
Use whenever answering anything version-sensitive — library/framework/SDK APIs, package versions, model IDs, pricing, CLI flags, config, or "latest/newest" anything. Verify against current sources instead of training data.
apiai
Systematic Debugging
Use when encountering any bug, test failure, or unexpected behavior, before proposing fixes
ai
Verification Before Completion
Use when about to claim work is complete, fixed, or passing, before committing or creating PRs - requires running verification commands and confirming output before making any success claims; evidence before assertions always
ai
Drill down: Ai setups by use case
Browse more topics
agentagent-skillsaiansibleanthropicapiarchitectureattestationauditautomationawsazurebenchmarkingbisectbrowserbuildcaptionschangelogchartsciclaudecleanupcloudflarecode-qualitycode-reviewcommitcompliancecomposecontainerscontentcontextcoveragecracsvd3datadatabasedebuggingdependenciesdeploymentdevelopmentdevopsdevtoolsdiagramsdiscorddjangodockerdocumentationdocumentsdocxdorae2eefficiencyembeddingengineering-code-qualityenvironmenteu-regulationevidenceexcelexplainerexplanationfaviconfilesflaskfrontendgcpgdprgitgithubgitlabgographqlhookshygieneimagesincident-responseindexesinfrastructureiosjavascriptjirakotlinkuberneteslearninglinearlintingllmmaintenancemcpmemorymermaidmetameta-tagsmigrationmigrationsmobilemonitoringmonorepomysqlnextjsnis2nodenpmofficialonboardingopenapioptimizationowasppackagesparsingpatternspdfperformanceplanningplaywrightpostgrespowerpointpptxprprivacyproductivityprofilingproject-managementprotocolprototypingpwapythonqaquery-optimizationragrapid-developmentreactredisrefactoringregexregistryregressionreleasereportsrestreviewrustsafetyschemascrapingsdksdlcsecuritysemverserversetupskillsslackslidesspreadsheetssqlsqliteswaggerswifttddteachingtest-generationtestingthreat-modelingtokenstranscripttypescriptutilityvalidationvercelversioningvibe-codingvideovisualizationvuevulnerabilitiesvulnerability-managementwebwordworkflowworkflowsworkspacexcodexlsxyoutube