Back to All Skills
Best Claude Code Skills for Python
30 skills tagged with “python”
Mcp Builder
Guide for creating high-quality MCP (Model Context Protocol) servers that enable LLMs to interact with external services through well-designed tools. Use when building MCP servers to integrate external APIs or services, whether in Python (FastMCP) or Node/TypeScript (MCP SDK).
pythontypescriptnodeapi+1
Xlsx
Use this skill any time a spreadsheet file is the primary input or output. This means any task where the user wants to: open, read, edit, or fix an existing .xlsx, .xlsm, .csv, or .tsv file (e.g., adding columns, computing formulas, formatting, charting, cleaning messy data); cr…
pythongoapirest
Customer Success Manager
Monitors customer health, predicts churn risk, and identifies expansion opportunities using weighted scoring models for SaaS customer success. Use when analyzing customer accounts, reviewing retention metrics, scoring at-risk customers, or when the user mentions churn, customer …
python
Internal Comms
Use when a Head of People Ops, BizOps lead, or Internal Communications owner needs to draft and sequence an internal-only change-management communication — a re-org announcement, a tool rollout, a policy change, a leadership transition, a layoff, an acquisition close, or an inte…
pythonai
Knowledge Ops
Use when a Head of Ops, Knowledge Manager, or TPM-Internal needs to author, validate, or clean up company SOPs and internal runbooks (procurement intake, vendor offboarding, incident-comms cascade, employee onboarding) — including 5W2H completeness checks (Who-What-When-Where-Wh…
pythongoai
Process Mapper
Use when a BizOps lead, COO, or process-improvement owner needs to document an end-to-end business process (procurement, employee onboarding, incident handoff, customer-onboarding, claims adjudication) in BPMN-style notation, measure cycle times by stage, surface where work spen…
pythonai
Code Reviewer
Code review automation for TypeScript, JavaScript, Python, Go, Swift, Kotlin, C#, .NET, Java, C, C++, Rust, Ruby, PHP, and Dart/Flutter. Analyzes PRs for complexity and risk, checks code quality for SOLID violations and code smells, generates review reports. Use when reviewing p…
pythontypescriptjavascriptrust+4
Engineering Skills
Index of the engineering-team skills bundle for Claude Code, Codex, Gemini CLI, Cursor, OpenClaw, and 6 more tools. Architecture, frontend, backend, QA, DevOps, security, AI/ML, data engineering, Playwright, Stripe, AWS, MS365 (stdlib-only Python tools). Use when browsing or cho…
pythonawssecurityai
Senior Data Engineer
Data engineering skill for building scalable data pipelines, ETL/ELT systems, and data infrastructure. Expertise in Python, SQL, Spark, Airflow, dbt, Kafka, and modern data stack. Includes data modeling, pipeline orchestration, data quality, and DataOps. Use when designing data …
pythongoai
Senior Data Scientist
World-class senior data scientist skill specialising in statistical modeling, experiment design, causal inference, and predictive analytics. Covers A/B testing (sample sizing, two-proportion z-tests, Bonferroni correction), difference-in-differences, feature engineering pipeline…
pythontesting
Senior Prompt Engineer
Use when the user asks to optimize prompts, design prompt templates, evaluate LLM outputs with an eval set, measure RAG retrieval quality, validate agent/tool configurations, analyze token usage, or design structured-output contracts. Covers eval-driven prompt iteration, RAG met…
pythonaillmrag+1
Snowflake Development
Use when writing Snowflake SQL, building data pipelines with Dynamic Tables or Streams/Tasks, using Cortex AI functions, creating Cortex Agents, writing Snowpark Python, configuring dbt for Snowflake, or troubleshooting Snowflake errors.
pythonaiagent
Chaos Engineering
Use when planning, running, or learning from chaos engineering experiments. Triggers on "chaos experiment", "fault injection", "gameday", "resilience test", "blast radius", "steady state", "abort criteria", "Chaos Toolkit", "Chaos Mesh", "Litmus", "Gremlin", "AWS FIS", or any de…
pythonawskubernetesai
Feature Flags Architect
Use when adding, retiring, or auditing feature flags. Triggers on "add a flag", "ship behind a flag", "rollout plan", "kill switch", "stale flags", "flag debt", "LaunchDarkly", "GrowthBook", "Statsig", "Unleash", "Flipt", or any progressive-delivery question. Ships flag debt sca…
python
Kubernetes Operator
Use when building a Kubernetes Operator — custom controllers that reconcile CRD state. Triggers on "build an operator", "CRD design", "reconcile loop", "controller-runtime", "kubebuilder", "operator-sdk", "metacontroller", "KOPF", "operator capability levels", or "custom resourc…
pythonkubernetes
Mcp Server Builder
Design and ship production-ready MCP (Model Context Protocol) servers from OpenAPI contracts instead of hand-written tool wrappers. Python and TypeScript support, schema validation, safe evolution. Use when exposing an existing API as an MCP server, building tool integrations fo…
pythontypescriptapi
Performance Profiler
Systematic performance profiling for Node.js, Python, and Go applications. Identifies CPU, memory, and I/O bottlenecks, generates flamegraphs, analyzes bundle sizes, optimizes database queries, runs load tests with k6 and Artillery. Always measures before and after. Use when inv…
pythongonodeperformance
Skill Security Auditor
Security audit and vulnerability scanner for AI agent skills before installation. Use when: (1) evaluating a skill from an untrusted source, (2) auditing a skill directory or git repo URL for malicious code, (3) pre-install security gate for Claude Code plugins, OpenClaw skills,…
pythonrustsecurityai+1
Skill Tester
Validate, test, and score the quality of skills within the claude-skills ecosystem. Comprehensive meta-skill: structure validation, Python script testing (syntax + imports + runtime + output format), multi-dimensional quality scoring with letter grades and tier classification (B…
pythontesting
Universal Scraping Architect
Use for web scraping, crawling, document extraction, API parsing, or building validation-heavy data pipelines using Firecrawl or local Python scripts.
pythonscrapingapi
Aeo
Answer Engine Optimization (AEO) skill — optimize content to be cited by AI language models (ChatGPT, Perplexity, Claude, Gemini, Mistral) as authoritative sources. Distinct from SEO — AEO optimizes for citation in LLM-generated responses, not search rankings. Use when planning …
pythonaillm
Marketing Skills
Directory and router for the marketing skills library. Use when you need to find the right marketing skill for a task, see what marketing capabilities exist, or get oriented in this plugin. 44 specialist skills across 8 pods (content, SEO + AEO, CRO, channels, growth, intelligen…
python
Scrum Master
Advanced Scrum Master skill for data-driven agile team analysis and coaching. Use when the user asks about sprint planning, velocity tracking, retrospectives, standup facilitation, backlog grooming, story points, burndown charts, blocker resolution, or agile team health. Runs Py…
pythonjira
Dummy Dataset
Generate realistic dummy datasets for testing with customizable columns, constraints, and output formats (CSV, JSON, SQL, Python script). Use when creating test data, building mock datasets, or generating sample data for development and demos.
pythontestingai
Api Testing
HTTP API testing for TypeScript (Supertest) and Python (httpx, pytest). Test REST APIs, GraphQL, request/response validation, authentication, and error handling.
pythontypescripttestingapi+2
Cloudflare Sandbox
Cloudflare Sandboxes SDK for secure code execution in Linux containers at edge. Use for untrusted code, Python/Node.js scripts, AI code interpreters, git operations.
pythonrustnodecloudflare+1
Cloudflare Workers Multi Lang
Multi-language Workers development with Rust, Python, and WebAssembly. Use when building Workers in languages other than JavaScript/TypeScript, or when integrating WASM modules for performance-critical code.
pythontypescriptjavascriptrust+2
Fastmcp
FastMCP Python framework for MCP servers with tools, resources, storage backends (memory/disk/Redis/DynamoDB). Use for Claude tool exposure, OAuth Proxy, cloud deployment, or encountering storage, lifespan, middleware, circular import, async errors.
pythonredisdeploymentrag
Mutation Testing
Validate test effectiveness with mutation testing using Stryker (TypeScript/JavaScript with Vitest or bun test via @hughescr/stryker-bun-runner) and mutmut (Python). Find weak tests that pass despite code mutations. Use to improve test quality.
pythontypescriptjavascripttesting
Playwright
Browser automation and E2E testing with Playwright. Auto-detects dev servers, writes clean test scripts. Test pages, fill forms, take screenshots, check responsive design, validate UX, test login flows, check links, automate any browser task. Use for cross-browser testing, visua…
pythontypescriptjavascripttesting+3
Browse more topics
agentagent-skillsaiansibleanthropicapiarchitectureattestationauditautomationawsazurebenchmarkingbisectbrowserbuildcaptionschangelogchartsciclaudecleanupcloudflarecode-qualitycode-reviewcommitcompliancecomposecontainerscontentcontextcoveragecracsvd3datadatabasedebuggingdependenciesdeploymentdevelopmentdevopsdevtoolsdiagramsdiscorddjangodockerdocumentationdocumentsdocxdorae2eefficiencyembeddingengineering-code-qualityenvironmenteu-regulationevidenceexcelexplainerexplanationfaviconfilesflaskfrontendgcpgdprgitgithubgitlabgographqlhookshygieneimagesincident-responseindexesinfrastructureiosjavascriptjirakotlinkuberneteslearninglinearlintingllmmaintenancemcpmemorymermaidmetameta-tagsmigrationmigrationsmobilemonitoringmonorepomysqlnextjsnis2nodenpmofficialonboardingopenapioptimizationowasppackagesparsingpatternspdfperformanceplanningplaywrightpostgrespowerpointpptxprprivacyproductivityprofilingprotocolprototypingpwapythonqaquery-optimizationragrapid-developmentreactredisrefactoringregexregressionreleasereportsrestreviewrustsafetyschemascrapingsdksdlcsecuritysemverserversetupskillsslackslidesspreadsheetssqlsqliteswaggerswifttddteachingtest-generationtestingthreat-modelingtokenstranscripttypescriptutilityvalidationvercelversioningvibe-codingvideovisualizationvuevulnerabilitiesvulnerability-managementwebwordworkflowworkflowsworkspacexcodexlsxyoutube